KEGG   Homo sapiens (human): 1337Help
Entry
1337              CDS       T01001                                 

Gene name
COX6A1, COX6A, COX6AL
Definition
cytochrome c oxidase subunit VIa polypeptide 1 (EC:1.9.3.1)
Orthology
K02266  
cytochrome c oxidase subunit 6a
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1337 (COX6A1)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    1337 (COX6A1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1337 (COX6A1)
   05012 Parkinson's disease
    1337 (COX6A1)
   05016 Huntington's disease
    1337 (COX6A1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1337 (COX6A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
12q24.2
AA seq 109 aa AA seqDB search
MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLK
SHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagttggtgtgtcctcggtttctcggctgctgggtcggtcccgcccacagctg
gggcggcctatgtcgagtggcgcccatggcgaagagggctcagctcgcatgtggaagact
ctcaccttcttcgtcgcgctccccggggtggcagtcagcatgctgaatgtgtacctgaag
tcgcaccacggagagcacgagagacccgagttcatcgcctacccccatctccgcatcagg
accaagccgtttccctggggagatggtaaccatactctattccataaccctcatgtgaat
ccacttccaactggctacgaagatgaataa

DBGET integrated database retrieval system