KEGG   Homo sapiens (human): 134Help
Entry
134               CDS       T01001                                 

Gene name
ADORA1, RDC7
Definition
(RefSeq) adenosine A1 receptor
  KO
K04265  
adenosine A1 receptor
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Sphingolipid signaling pathway
Neuroactive ligand-receptor interaction
Regulation of lipolysis in adipocytes
Renin secretion
Morphine addiction
Drug target
Adenosine: 
Caffeine: 
Choline theophyllinate: 
Proxyphylline: 
Theophylline: 
Aminophylline: 
Bamifylline: 
Doxofylline: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    134 (ADORA1)
   04024 cAMP signaling pathway
    134 (ADORA1)
   04022 cGMP - PKG signaling pathway
    134 (ADORA1)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    134 (ADORA1)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    134 (ADORA1)
   04924 Renin secretion
    134 (ADORA1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    134 (ADORA1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Adenosine
    134 (ADORA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q32.1
AA seq 326 aa AA seqDB search
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctccatctcagctttccaggccgcctacatcggcatcgaggtgctcatcgcc
ctggtctctgtgcccgggaacgtgctggtgatctgggcggtgaaggtgaaccaggcgctg
cgggatgccaccttctgcttcatcgtgtcgctggcggtggctgatgtggccgtgggtgcc
ctggtcatccccctcgccatcctcatcaacattgggccacagacctacttccacacctgc
ctcatggttgcctgtccggtcctcatcctcacccagagctccatcctggccctgctggca
attgctgtggaccgctacctccgggtcaagatccctctccggtacaagatggtggtgacc
ccccggagggcggcggtggccatagccggctgctggatcctctccttcgtggtgggactg
acccctatgtttggctggaacaatctgagtgcggtggagcgggcctgggcagccaacggc
agcatgggggagcccgtgatcaagtgcgagttcgagaaggtcatcagcatggagtacatg
gtctacttcaacttctttgtgtgggtgctgcccccgcttctcctcatggtcctcatctac
ctggaggtcttctacctaatccgcaagcagctcaacaagaaggtgtcggcctcctccggc
gacccgcagaagtactatgggaaggagctgaagatcgccaagtcgctggccctcatcctc
ttcctctttgccctcagctggctgcctttgcacatcctcaactgcatcaccctcttctgc
ccgtcctgccacaagcccagcatccttacctacattgccatcttcctcacgcacggcaac
tcggccatgaaccccattgtctatgccttccgcatccagaagttccgcgtcaccttcctt
aagatttggaatgaccatttccgctgccagcctgcacctcccattgacgaggatctccca
gaagagaggcctgatgactag

DBGET integrated database retrieval system