KEGG   Homo sapiens (human): 134430Help
Entry
134430            CDS       T01001                                 

Gene name
WDR36, GLC1G, TA-WDRP, TAWDRP, UTP21
Definition
WD repeat domain 36
Orthology
K14554  
U3 small nucleolar RNA-associated protein 21
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
Disease
H00612  
Primary open angle glaucoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    134430 (WDR36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q22.1
AA seq 951 aa AA seqDB search
MCCTEGSLRKRDSQRAPEAVLCLQLWQRTVPLDTLKGLGTCFPSGPELRGAGIAAAMERA
SERRTASALFAGFRALGLFSNDIPHVVRFSALKRRFYVTTCVGKSFHTYDVQKLSLVAVS
NSVPQDICCMAADGRLVFAAYGNVFSAFARNKEIVHTFKGHKAEIHFLQPFGDHIISVDT
DGILIIWHIYSEEEYLQLTFDKSVFKISAILHPSTYLNKILLGSEQGSLQLWNVKSNKLL
YTFPGWKVGVTALQQAPAVDVVAIGLMSGQVIIHNIKFNETLMKFRQDWGPITSISFRTD
GHPVMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAIAGLTFLHREPLLVTNGADNALRIW
IFDGPTGEGRLLRFRMGHSAPLTNIRYYGQNGQQILSASQDGTLQSFSTVHEKFNKSLGH
GLINKKRVKRKGLQNTMSVRLPPITKFAAEEARESDWDGIIACHQGKLSCSTWNYQKSTI
GAYFLKPKELKKDDITATAVDITSCGNFAVIGLSSGTVDVYNMQSGIHRGSFGKDQAHKG
SVRGVAVDGLNQLTVTTGSEGLLKFWNFKNKILIHSVSLSSSPNIMLLHRDSGILGLALD
DFSISVLDIETRKIVREFSGHQGQINDMAFSPDGRWLISAAMDCSIRTWDLPSGCLIDCF
LLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVMLPGTC
QTQDVEVSEETVEPSDELIEYDSPEQLNEQLVTLSLLPESRWKNLLNLDVIKKKNKPKEP
PKVPKSAPFFIPTIPGLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDFCLKLEEGLVNNKY
DTALNLLKESGPSGIETELRSLSPDCGGSIEVMQSFLKMIGMMLDRKRDFELAQAYLALF
LKLHLKMLPSEPVLLEEITNLSSQVEENWTHLQSLFNQSMCILNYLKSALL
NT seq 2856 nt NT seq  +upstreamnt  +downstreamnt
atgtgttgcactgagggcagtctccggaaacgcgattcgcagcgggcgccggaagcggtg
ttgtgtctgcagctctggcagaggactgttccactagacacgctgaagggactgggtacg
tgttttccttcaggaccagagctgagaggagctgggatcgcggcggcaatggaacgggcc
tcagaaaggcgcacggccagcgcgctttttgcggggttccgggccttgggacttttcagc
aacgacattccacacgtggtgcggttcagcgcgctcaagcgccggttctatgtaacaacc
tgcgtgggcaagagtttccacacctatgacgttcagaaacttagtctggttgcagtaagt
aattctgttccacaggatatctgctgtatggcagctgatggcagattagtctttgctgct
tatggaaatgttttctctgcatttgcccgtaataaagagatagtacatacctttaagggt
cataaggcagaaatccatttcttgcaaccctttggagaccacattatctctgttgatact
gatggcattcttattatttggcacatatattcagaagaagaatacctgcagttgactttt
gataaatcagtatttaaaatttctgcaattttgcatccaagtacctacttgaataaaata
cttctgggcagtgaacaaggaagcctgcagttgtggaatgtaaaatccaataaacttcta
tatacatttccaggatggaaagttggagtgacagctcttcagcaggcaccagccgtggat
gttgttgctattggtcttatgtcaggtcaagttatcattcacaacattaaatttaatgaa
acattaatgaagtttcgtcaagactggggacccattacttcaatttcatttcgcacagat
ggtcatccagtaatggcagctggaagcccatgtggccatattggactctgggatctagaa
gacaaaaaattaatcaaccaaatgagaaatgcacactctacagcaattgccggactgaca
tttctccatagagagccacttcttgtcacaaatggcgctgacaatgctcttaggatatgg
atatttgatggtcctacaggtgaaggccgacttttgagattcagaatgggtcatagtgct
cctcttaccaatatcagatattatggacagaatggacagcagattctaagtgcaagtcaa
gatggaactcttcagtcattttccacggtacatgaaaaattcaataagagcttgggacat
ggattaataaataaaaagagagttaaacgtaaaggacttcagaataccatgtcagtgaga
cttccacccatcacaaagtttgcagcagaggaagctcgtgaaagtgactgggatggtatc
attgcttgccatcaaggtaagctatcttgctcaacctggaattatcagaaatctacaata
ggcgcttactttctcaagccaaaagagttgaagaaagatgacataactgcaacagcagtg
gatataacttcttgtggaaactttgctgtaattggcctctcatcaggaactgtagatgta
tataacatgcagtctggcatacatcgaggaagttttggcaaggatcaagctcacaaggga
tctgttagaggtgtcgcagtggatggattaaaccagttgacagttacaactggtagtgaa
ggattactcaaattctggaactttaaaaacaaaattttaatccattctgtgagcctcagt
tcatctccaaatatcatgttgctacatagggacagtggcattctgggactcgccttggat
gacttctccattagtgttctggacatagaaactaggaagattgtcagagagttttctgga
caccaaggccaaataaatgacatggcttttagtcctgatggtcgttggttaataagtgct
gcgatggattgctctattaggacttgggaccttccttctgggtgccttatagactgcttt
ttgttggactcggctcctctcaatgtttctatgtctcctactggagactttctggcaact
tcccatgtggaccaccttggaatttatctatggtccaatatttccctgtattcagttgtt
tcattacggccacttcctgcagattatgtcccttcaatagtcatgcttcctggtacttgt
caaacccaagatgtagaagtatcagaagaaacagtagaaccaagtgatgaattgatagaa
tatgattcgccagaacagttgaatgagcaattggtgactctttcacttcttcctgaatca
cgatggaaaaaccttcttaaccttgatgttattaagaaaaagaataaaccaaaggaacca
cccaaagtacccaaatcagcaccatttttcattccaacaattcctggccttgtacccaga
tatgctgcacctgaacaaaataatgatccccagcagtctaaagtggtaaatcttggagtt
ttggctcaaaaatcagatttctgcttgaaacttgaagaaggactggtaaataataagtat
gacactgctctcaaccttctgaaagaatcaggcccatcaggaattgaaacagagctgcga
agcttgtctcctgattgtggtgggtccatagaagttatgcagagcttcttgaaaatgatt
gggatgatgctggacagaaagcgtgattttgagttagcccaggcataccttgcattgttt
ctaaagttacaccttaaaatgcttccttcagagccagtactcctagaagaaataacaaat
ttgtcatcccaggtggaagaaaactggacccatttgcaatcactcttcaatcaaagcatg
tgtattttaaattatctcaaaagtgctttgttgtaa

DBGET integrated database retrieval system