KEGG   Homo sapiens (human): 1345Help
Entry
1345              CDS       T01001                                 

Gene name
COX6C
Definition
(RefSeq) cytochrome c oxidase subunit 6C
  KO
K02268  cytochrome c oxidase subunit 6c
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1345 (COX6C)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    1345 (COX6C)
  Environmental adaptation
   04714 Thermogenesis
    1345 (COX6C)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1345 (COX6C)
   05012 Parkinson's disease
    1345 (COX6C)
   05016 Huntington's disease
    1345 (COX6C)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1345 (COX6C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX6C
Motif
Other DBs
NCBI-GeneID: 1345
NCBI-ProteinID: NP_004365
OMIM: 124090
HGNC: 2285
Ensembl: ENSG00000164919
Vega: OTTHUMG00000164703
Pharos: P09669(Tbio)
UniProt: P09669 A0A024R9B7
Position
8q22.2
AA seq 75 aa AA seqDB search
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK
DFEEMRKAGIFQSVK
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgaagttttgccaaaacctcggatgcgtggccttctggccaggcgtctgcga
aatcatatggctgtagcattcgtgctatccctgggggttgcagctttgtataagtttcgt
gtggctgatcaaagaaagaaggcatacgcagatttctacagaaactacgatgtcatgaaa
gattttgaggagatgaggaaggctggtatctttcagagtgtaaagtaa

DBGET integrated database retrieval system