KEGG   Homo sapiens (human): 1345Help
Entry
1345              CDS       T01001                                 

Gene name
COX6C
Definition
cytochrome c oxidase subunit VIc (EC:1.9.3.1)
Orthology
K02268  
cytochrome c oxidase subunit 6c
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1345 (COX6C)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    1345 (COX6C)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1345 (COX6C)
   05012 Parkinson's disease
    1345 (COX6C)
   05016 Huntington's disease
    1345 (COX6C)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1345 (COX6C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q22.2
AA seq 75 aa AA seqDB search
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK
DFEEMRKAGIFQSVK
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgaagttttgccaaaacctcggatgcgtggccttctggccaggcgtctgcga
aatcatatggctgtagcattcgtgctatccctgggggttgcagctttgtataagtttcgt
gtggctgatcaaagaaagaaggcatacgcagatttctacagaaactacgatgtcatgaaa
gattttgaggagatgaggaaggctggtatctttcagagtgtaaagtaa

DBGET integrated database retrieval system