KEGG   Homo sapiens (human): 1345Help
Entry
1345              CDS       T01001                                 

Gene name
COX6C
Definition
cytochrome c oxidase subunit VIc (EC:1.9.3.1)
Orthology
K02268  
cytochrome c oxidase subunit 6c
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Organismal Systems; Circulatory system; Cardiac muscle contraction [PATH:hsa04260]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:hsa05010]
Human Diseases; Neurodegenerative diseases; Parkinson's disease [PATH:hsa05012]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:hsa05016]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:hsa04932]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q22.2
AA seq 75 aa AA seqDB search
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK
DFEEMRKAGIFQSVK
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atggctcccgaagttttgccaaaacctcggatgcgtggccttctggccaggcgtctgcga
aatcatatggctgtagcattcgtgctatccctgggggttgcagctttgtataagtttcgt
gtggctgatcaaagaaagaaggcatacgcagatttctacagaaactacgatgtcatgaaa
gattttgaggagatgaggaaggctggtatctttcagagtgtaaagtaa

DBGET integrated database retrieval system