KEGG   Homo sapiens (human): 134526Help
Entry
134526            CDS       T01001                                 

Gene name
ACOT12, CACH-1, Cach, STARD15, THEAL
Definition
(RefSeq) acyl-CoA thioesterase 12 (EC:3.1.2.1)
  KO
K01067  
acetyl-CoA hydrolase [EC:3.1.2.1]
Organism
hsa  Homo sapiens (human)
Pathway
Pyruvate metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    134526 (ACOT12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.1  acetyl-CoA hydrolase
     134526 (ACOT12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
5q14.1
AA seq 555 aa AA seqDB search
MERPAPGEVVMSQAIQPAHATARGELSAGQLLKWIDTTACLAAEKHAGVSCVTASVDDIQ
FEETARVGQVITIKAKVTRAFSTSMEISIKVMVQDMLTGIEKLVSVAFSTFVAKPVGKEK
IHLKPVTLLTEQDHVEHNLAAERRKVRLQHEDTFNNLMKESSKFDDLIFDEEEGAVSTRG
TSVQSIELVLPPHANHHGNTFGGQIMAWMETVATISASRLCWAHPFLKSVDMFKFRGPST
VGDRLVFTAIVNNTFQTCVEVGVRVEAFDCQEWAEGRGRHINSAFLIYNAADDKENLITF
PRIQPISKDDFRRYRGAIARKRIRLGRKYVISHKEEVPLCIHWDISKQASLSDSNVEALK
KLAAKRGWEVTSTVEKIKIYTLEEHDVLSVWVEKHVGSPAHLAYRLLSDFTKRPLWDPHF
VSCEVIDWVSEDDQLYHITCPILNDDKPKDLVVLVSRRKPLKDGNTYTVAVKSVILPSVP
PSPQYIRSEIICAGFLIHAIDSNSCIVSYFNHMSASILPYFAGNLGGWSKSIEETAASCI
QFLENPPDDGFVSTF
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggagcggccggcgcccggcgaggtggtcatgagccaagccatccagccggcgcacgcc
actgcgcgcggcgagctgagcgcggggcagctgctcaagtggatcgacaccaccgcctgc
ctggcggctgagaaacatgctggagtttcctgcgttacagcctcagtggatgacatacag
tttgaggagacagctagagttggacaagttataaccatcaaagcaaaagttactagagca
ttcagcacaagcatggagatcagtatcaaggtcatggtacaggatatgctcactggcatt
gagaagcttgttagtgtggctttctccacatttgtagccaaaccagttggaaaagaaaag
attcatttaaaaccagtcacacttctaactgaacaagatcatgtggaacataatctggct
gctgagagaaggaaagttcgattacaacatgaagatacctttaacaatttaatgaaggaa
agtagcaaatttgatgatctcatttttgatgaagaggaaggagcggtttccacaaggggc
acctccgttcagagcattgaactggtcctcccaccccatgcaaaccatcacggaaataca
tttggtggccagattatggcgtggatggagacagtggctactatttctgcaagccgcctg
tgttgggctcatccctttctgaagtccgtagatatgtttaagttccggggaccatctaca
gttggagatcgtcttgtcttcactgccattgtcaacaatacatttcagacctgtgttgaa
gttggagttcgcgtggaggcctttgactgtcaggaatgggccgagggccgagggcgtcac
atcaacagtgcttttctcatttacaatgctgctgatgataaggaaaatctcatcacgttt
cccagaatccaacccatttcaaaggatgatttcagacgctatcggggagctattgcacgc
aagcgaattcgcctaggcagaaaatatgttatttcccacaaagaagaggttccactttgc
atacactgggatatcagcaagcaggcatccctgagtgacagcaatgtggaggccctcaaa
aaactggcagccaaaaggggttgggaggttaccagcactgtggaaaagataaaaatatat
actctggaagagcatgatgttttatctgtttgggttgaaaagcacgtgggaagtccagca
catttggcttatcgtctcttgtctgactttacaaagcgacctttgtgggacccccatttt
gtgtcctgtgaagtcatagactgggtgagtgaagatgatcagctgtatcacatcacctgt
cctatactgaatgatgacaaacccaaagacttggtagtactcgtatcacgaagaaaaccc
ctcaaagatggtaacacttacacagtggcagtgaagtcggtcattttgccatcggtcccc
ccgtctccacagtacatcagaagtgaaatcatatgtgccggatttctcatccatgctatt
gacagcaattcatgcatcgtatcttactttaaccatatgtctgctagcatccttccttac
tttgctggaaatcttggtggctggtcaaaatccattgaagaaacagcagcctcttgtata
cagttcttagagaatcctcctgatgatgggtttgtaagcacattttaa

DBGET integrated database retrieval system