KEGG   Homo sapiens (human): 134548Help
Entry
134548            CDS       T01001                                 

Gene name
SOWAHA, ANKRD43
Definition
sosondowah ankyrin repeat domain family member A
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q31.1
AA seq 549 aa AA seqDB search
MALAAAAAAAAAGVSQAAVLGFLQEHGGKVRNSELLSRFKPLLDAGDPRGRAARRDRFKQ
FVNNVAVVKELDGVKFVVLRKKPRPPEPEPAPFGPPGAAAQPSKPTSTVLPRSASAPGAP
PLVRVPRPVEPPGDLGLPTEPQDTPGGPASEPAQPPGERSADPPLPALELAQATERPSAD
AAPPPRAPSEAASPCSDPPDAEPGPGAAKGPPQQKPCMLPVRCVPAPATLRLRAEEPGLR
RQLSEEPSPRSSPLLLRRLSVEESGLGLGLGPGRSPHLRRLSRAGPRLLSPDAEELPAAP
PPSAVPLEPSEHEWLVRTAGGRWTHQLHGLLLRDRGLAAKRDFMSGFTALHWAAKSGDGE
MALQLVEVARRSGAPVDVNARSHGGYTPLHLAALHGHEDAAVLLVVRLGAQVHVRDHSGR
RAYQYLRPGSSYALRRLLGDPGLRGTTEPDATGGGSGSLAARRPVQVAATILSSTTSAFL
GVLADDLMLQDLARGLKKSSSFSKFLSASPMAPRKKTKIRGGLPAFSEISRRPTPGPLAG
LVPSFPPTT
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggccgccgccgccgccgctgcggctgccggggtgagccaggcggcggtgctg
ggcttcctgcaggagcacggcgggaaggtgcgcaactccgagctgctgagccgcttcaag
ccgctgctcgatgccggcgacccgcggggccgcgccgcccgcagggaccgcttcaagcag
ttcgtcaacaacgtggcggtggtgaaggagctcgacggcgtcaagttcgtggtgctgagg
aagaagccccggcccccggagcccgagcccgcacccttcggccccccgggggcagcggcc
cagccgtcgaaacccacttcgacggtcttgccgcggagcgcctctgccccgggagctccg
cccttggtccgggtgccgcggccagtggagccgccaggggacctgggtctgccaacagag
ccacaggacaccccgggggggccggcctccgagcccgctcagccgcccggggagcggtcc
gccgacccaccgcttccagcccttgagctagcccaggccaccgagagaccctccgcagac
gcggccccaccgcctagggccccttctgaggcggcatcgccctgctctgatccgccagac
gcggagcccgggcccggggcagcgaaagggccgccgcagcagaagccctgtatgctgccg
gtgcgctgcgtcccggcccccgccacgctccgcctccgggcggaggagcccggcctgcgc
cggcagctgtcggaggagccgagcccgcggagctcccctctgctgctgaggcggctctcg
gtggaagagtccggtctgggcctcggcctgggcccgggccgctccccgcacctgaggcgc
ctgtcgcgcgccggcccgcgtctgctgagccctgacgccgaggagttgcccgccgcgccg
ccgccgtccgcggtgcccctggagccgtccgagcacgagtggctcgtgcggactgccggg
ggccgctggacccaccagctgcacgggctgctgctgcgcgaccgcggcttggcggccaag
cgcgacttcatgtctggcttcacggccctgcattgggccgccaagagcggcgacggcgag
atggcgctgcagctggtggaggtcgcgcggcgcagtggcgcaccagtcgacgtgaacgca
cgctcccacggcggctacacgccgctgcacctggctgcactgcacggccacgaggacgct
gccgtgctgctggtggtgcgtctgggtgcccaggtgcacgtgcgtgatcacagcgggcgt
cgcgcctaccagtacctgcggcccggctcctcgtacgcgctgcgccgccttcttggcgat
ccaggcctgcgaggcaccacggagccagatgcgaccggtggtggaagtggcagtcttgct
gccaggcgccccgtacaggtggccgccaccatcctcagttccaccaccagtgcatttctg
ggcgtcctggctgacgacctcatgctccaggacctggcccgaggcttgaagaagtcgagc
tccttcagcaagttcttgagcgcctcgcccatggctccacgtaaaaagacaaagatccgc
ggtggtctgccagccttctcagaaatctctcgtcgacctactccggggcctttagctggt
ctagtgcccagttttcctccaacaacctga

DBGET integrated database retrieval system