KEGG   Homo sapiens (human): 1347Help
Entry
1347              CDS       T01001                                 

Gene name
COX7A2, COX7AL, COX7AL1, COXVIIAL, COXVIIa-L, VIIAL
Definition
(RefSeq) cytochrome c oxidase subunit 7A2 (EC:1.9.3.1)
  KO
K02270  
cytochrome c oxidase subunit 7a
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1347 (COX7A2)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    1347 (COX7A2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1347 (COX7A2)
   05012 Parkinson's disease
    1347 (COX7A2)
   05016 Huntington's disease
    1347 (COX7A2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1347 (COX7A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q12
AA seq 115 aa AA seqDB search
MHTQDSEVVPVPAWPFSLVVFSCGGCWSVTAKMLRNLLALRQIGQRTISTASRRHFKNKV
PEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcatacgcaagactcggaggtagttccggttccggcgtggccattttcgttggtggtg
ttcagttgtggcggttgctggtcagtaacagccaagatgctgcggaatctgctggctctt
cgtcagattgggcagaggacgataagcactgcttcccgcaggcattttaaaaataaagtt
ccggagaagcaaaaactgttccaggaggatgatgaaattccactgtatctaaagggtggg
gtagctgatgccctcctgtatagagccaccatgattcttacagttggtggaacagcatat
gccatatatgagctggctgtggcttcatttcccaagaagcaggagtga

DBGET integrated database retrieval system