KEGG   Homo sapiens (human): 134864Help
Entry
134864            CDS       T01001                                 

Gene name
TAAR1, RP11-295F4.9, TA1, TAR1, TRAR1
Definition
trace amine associated receptor 1
Orthology
K05051  
trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6q23.2
AA seq 339 aa AA seqDB search
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID
RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG
GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG
ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN
PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccttttgccacaatataattaatatttcctgtgtgaaaaacaactggtcaaat
gatgtccgtgcttccctgtacagtttaatggtgctcataattctgaccacactcgttggc
aatctgatagttattgtttctatatcacacttcaaacaacttcataccccaacaaattgg
ctcattcattccatggccactgtggactttcttctggggtgtctggtcatgccttacagt
atggtgagatctgctgagcactgttggtattttggagaagtcttctgtaaaattcacaca
agcaccgacattatgctgagctcagcctccattttccatttgtctttcatctccattgac
cgctactatgctgtgtgtgatccactgagatataaagccaagatgaatatcttggttatt
tgtgtgatgatcttcattagttggagtgtccctgctgtttttgcatttggaatgatcttt
ctggagctaaacttcaaaggcgctgaagagatatattacaaacatgttcactgcagagga
ggttgctctgtcttctttagcaaaatatctggggtactgacctttatgacttctttttat
atacctggatctattatgttatgtgtctattacagaatatatcttatcgctaaagaacag
gcaagattaattagtgatgccaatcagaagctccaaattggattggaaatgaaaaatgga
atttcacaaagcaaagaaaggaaagctgtgaagacattggggattgtgatgggagttttc
ctaatatgctggtgccctttctttatctgtacagtcatggacccttttcttcactacatt
attccacctactttgaatgatgtattgatttggtttggctacttgaactctacatttaat
ccaatggtttatgcatttttctatccttggtttagaaaagcactgaagatgatgctgttt
ggtaaaattttccaaaaagattcatccaggtgtaaattatttttggaattgagttcatag

DBGET integrated database retrieval system