KEGG   Homo sapiens (human): 1351Help
Entry
1351              CDS       T01001                                 

Gene name
COX8A, COX, COX8, COX8-2, COX8L, VIII, VIII-L
Definition
cytochrome c oxidase subunit VIIIA (ubiquitous) (EC:1.9.3.1)
Orthology
K02273  
cytochrome c oxidase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Non-alcoholic fatty liver disease (NAFLD)
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1351 (COX8A)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    1351 (COX8A)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1351 (COX8A)
   05012 Parkinson's disease
    1351 (COX8A)
   05016 Huntington's disease
    1351 (COX8A)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1351 (COX8A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
11q12-q13
AA seq 69 aa AA seqDB search
MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS
HLETYRRPE
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtcctgacgccgctgctgctgcggggcttgacaggctcggcccggcggctccca
gtgccgcgcgccaagatccattcgttgccgccggaggggaagcttgggatcatggaattg
gccgttgggcttacctcctgcttcgtgaccttcctcctgccagcgggctggatcctgtca
cacctggagacctacaggaggccagagtga

DBGET integrated database retrieval system