KEGG   Homo sapiens (human): 1352Help
Entry
1352              CDS       T01001                                 

Gene name
COX10
Definition
(RefSeq) COX10, heme A:farnesyltransferase cytochrome c oxidase assembly factor
  KO
K02257  
protoheme IX farnesyltransferase [EC:2.5.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cytochrome c oxidase
Disease
H01354  
Leigh syndrome
H01368  
Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1352 (COX10)
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    1352 (COX10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.-  
     1352 (COX10)
Prenyltransferases [BR:hsa01006]
 Compound prenylation
  Protoheme farnesyltransferase
   1352 (COX10)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    1352 (COX10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q12887(Tbio)
UniProt: 
Position
17p12
AA seq 443 aa AA seqDB search
MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMY
VTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIE
LEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLSKIKLTALVVSTTAAGFALA
PGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFA
TCCAVPGVAILTLGVNPLTGALGLFNIFLYTCCYTPLKRISIANTWVGAVVGAIPPVMGW
TAATGSLDAGAFLLGGILYSWQFPHFNALSWGLREDYSRGGYCMMSVTHPGLCRRVALRH
CLALLVLSAAAPVLDITTWTFPIMALPINAYISYLGFRFYVDADRRSSRRLFFCSLWHLP
LLLLLMLTCKRPSGGGDAGPPPS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggccgcatctccgcacactctctcctcacgcctcctgacaggttgcgtaggaggctct
gtctggtatcttgaaagaagaactatacaggactcccctcacaagttcttacatcttctc
aggaatgtcaataagcagtggattacatttcagcactttagcttcctcaaacgcatgtat
gtcacacagctgaacagaagccacaaccagcaagtaagacccaagccagaaccagtagca
tctcctttccttgaaaaaacatcttcaggtcaagccaaagcagaaatatatgagatgaga
cctctctcaccgcccagcctatctttgtccagaaagccaaatgaaaaggaattgatagaa
ctagagccagactcagtaattgaagactcaatagatgtagggaaagagacaaaagaggaa
aagcggtggaaagagatgaagctgcaagtgtatgatttgccaggaattttggctcgacta
tccaaaatcaaactcacagctctggttgtaagtaccactgcagctggatttgcattggct
ccgggcccttttgactggccctgtttcctgcttacttctgttgggacaggccttgcatcc
tgtgctgccaactccatcaatcagttttttgaggtgccatttgactcaaacatgaatagg
acaaagaacagaccgctggttcgtggacagatcagcccattgctagctgtgtcctttgcc
acttgttgtgctgttccgggagttgccattctgaccttgggggtgaatccactcacagga
gccctggggctcttcaacattttcctgtatacctgctgctacacaccactgaaaaggatc
agcattgccaacacatgggtcggagctgtggttggggccatcccgcctgtcatgggctgg
acagcggccacgggcagcctcgatgctggcgcatttctcctgggaggaatcctctactcc
tggcagtttcctcatttcaacgccctgagctggggcctccgtgaagactactcccggggc
ggctactgcatgatgtcggtcacccacccgggcctgtgccggcgcgtggcgctgcgccac
tgcctggccctgctcgtgctgtccgcagcagcccctgtgctggacatcaccacatggacc
ttccccatcatggcccttcccatcaatgcgtacatctcctacctcggcttccgcttctac
gtggacgcagaccgcaggagctcgcggagactgttcttctgcagcctgtggcacctgccg
ctgctgctgctgctcatgctcacctgcaagcggccgagcggaggcggggacgcagggccc
cctcccagctga

DBGET integrated database retrieval system