KEGG   Homo sapiens (human): 1353Help
Entry
1353              CDS       T01001                                 

Gene name
COX11, COX11P
Definition
cytochrome c oxidase assembly homolog 11 (yeast)
Orthology
K02258  
cytochrome c oxidase assembly protein subunit 11
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1353 (COX11)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    1353 (COX11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17q22
AA seq 230 aa AA seqDB search
MGGLWRPGWRCVPFCGWRWIHPGSPTRAAERVEPFLRPEWSGTGGAERGLRWLGTWKRCS
LRARHPALQPPRRPKSSNPFTRAQEEERRRQNKTTLTYVAAVAVGMLGASYAAVPLYRLY
CQTTGLGGSAVAGHASDKIENMVPVKDRIIKISFNADVHASLQWNFRPQQTEIYVVPGET
ALAFYRAKNPTDKPVIGISTYNIVPFEAGQYFNKIQVLSSRLQSCTESTF
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgggagggctctggcgtcctggatggaggtgcgttcctttctgtggctggcgctggatc
caccctgggtctccaaccagggctgcagagagggtagagccgtttcttaggccagagtgg
agtgggacaggaggtgccgagagaggactgaggtggcttgggacatggaagcgctgcagc
cttcgagcccggcatccagcattgcagccgccgcggcggcctaagagctcgaaccctttc
acacgcgcgcaggaggaggagcggcggcggcagaacaagacgaccctcacttacgtggcc
gctgtcgccgtgggcatgctgggggcgtcctacgctgccgtacccctttatcggctctat
tgccagactactggacttggaggatcagcagttgcaggtcatgcctcagacaagattgaa
aacatggtgcctgttaaagatcgaatcattaaaattagctttaatgcagatgtgcatgca
agtctccagtggaactttagacctcagcaaacagaaatatatgtggtgccaggagagact
gcactggcgttttacagagctaagaatcctactgacaaaccagtaattggaatttctaca
tacaatattgttccatttgaagctggacagtatttcaataaaatacaggtattgtcttcc
aggcttcaaagctgcacagagtctacgttttag

DBGET integrated database retrieval system