KEGG   Homo sapiens (human): 1355Help
Entry
1355              CDS       T01001                                 

Gene name
COX15, CEMCOX2
Definition
(RefSeq) COX15, cytochrome c oxidase assembly homolog
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
Module
hsa_M00154  Cytochrome c oxidase
Disease
H01200  Fatal infantile cardioencephalomyopathy
H01354  Leigh syndrome
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1355 (COX15)
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    1355 (COX15)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    1355 (COX15)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    1355 (COX15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX15-CtaA Peptidase_S3
Motif
Other DBs
NCBI-GeneID: 1355
NCBI-ProteinID: NP_510870
OMIM: 603646
HGNC: 2263
Ensembl: ENSG00000014919
Vega: OTTHUMG00000018893
Pharos: Q7KZN9(Tbio)
UniProt: Q7KZN9
Position
10q24.2
AA seq 410 aa AA seqDB search
MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGRGTVSL
PSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAE
FQRYQQFPEFKILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGM
KGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWT
SLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESW
IPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLPRRTKMAAVTL
LALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgattgctctttccgccgttgagggccttgaaggggaggcagtatctgccgctc
ctggctcctagggcagcgcctagagcacagtgtgattgcatcaggcgccctttgaggcca
gggcaatacagcaccatctctgaagtagctttgcaatctggaaggggtacagtgtccctt
ccctcaaaggctgctgagcgggtggtgggccgatggctcctggtctgcagtggaacagtg
gctggagcagttattcttggtggagtaactaggttgacagagtctggcctctcgatggta
gattggcatttaataaaggagatgaagccacctacaagccaagaggaatgggaagcagaa
ttccaaagataccagcaatttccagaatttaaaatcttgaatcatgatatgacactgaca
gaattcaagttcatctggtacatggagtactcacaccgaatgtggggtcgccttgtaggc
cttgtgtacatcctgcctgctgcctacttttggagaaagggctggctcagccgtggcatg
aaaggacgtgttcttgccctctgtggcctcgtctgcttccagggtctgttgggatggtat
atggtgaaaagtggactagaagaaaaatcagactcccatgacatccctcgggtcagtcag
taccgccttgctgcccacctgggatcagccctggttctttattgtgccagcttgtggacc
tcactgtcactgctactccctccgcacaagttgcctgaaacccaccaactcctacagttg
agacgatttgctcatggaacagcaggtctggtgttccttacggccctctcaggggctttt
gtggcagggctagatgctgggcttgtttataactcctttcccaaaatgggagaatcctgg
atcccggaggacctctttaccttctcccccatcctgaggaatgtttttgagaatcccacc
atggtgcagtttgatcaccggattctgggaatcacttcagtcactgccattacagtgctc
tacttcctctctcggagaattccccttcctagaaggaccaagatggcagcagtgactctg
ctggctttggcgtatacacaggtgggcttgggcatcagcacgctgctgatgtatgtccca
actcctctggccgccactcaccagtcaggctccttggctttgctcactggtgctctttgg
ctgatgaatgaactccgaagagtcccaaaatga

DBGET integrated database retrieval system