KEGG   Homo sapiens (human): 1355Help
Entry
1355              CDS       T01001                                 

Gene name
COX15, CEMCOX2
Definition
cytochrome c oxidase assembly homolog 15 (yeast)
Orthology
K02259  
cytochrome c oxidase assembly protein subunit 15
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Porphyrin and chlorophyll metabolism
Metabolic pathways
Module
Cytochrome c oxidase
Disease
H01200  
Fatal infantile cardioencephalomyopathy
H01354  
Leigh syndrome
H01368  
Cytochrome c oxidase (COX) deficiency
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:hsa00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Position
10q24
AA seq 388 aa AA seqDB search
MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGRGTVSL
PSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAE
FQRYQQFPEFKILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGM
KGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWT
SLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESW
IPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLPRRTKMAAVTL
LALAYTQGPVLFNFTFKISDLDEGIRNI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgattgctctttccgccgttgagggccttgaaggggaggcagtatctgccgctc
ctggctcctagggcagcgcctagagcacagtgtgattgcatcaggcgccctttgaggcca
gggcaatacagcaccatctctgaagtagctttgcaatctggaaggggtacagtgtccctt
ccctcaaaggctgctgagcgggtggtgggccgatggctcctggtctgcagtggaacagtg
gctggagcagttattcttggtggagtaactaggttgacagagtctggcctctcgatggta
gattggcatttaataaaggagatgaagccacctacaagccaagaggaatgggaagcagaa
ttccaaagataccagcaatttccagaatttaaaatcttgaatcatgatatgacactgaca
gaattcaagttcatctggtacatggagtactcacaccgaatgtggggtcgccttgtaggc
cttgtgtacatcctgcctgctgcctacttttggagaaagggctggctcagccgtggcatg
aaaggacgtgttcttgccctctgtggcctcgtctgcttccagggtctgttgggatggtat
atggtgaaaagtggactagaagaaaaatcagactcccatgacatccctcgggtcagtcag
taccgccttgctgcccacctgggatcagccctggttctttattgtgccagcttgtggacc
tcactgtcactgctactccctccgcacaagttgcctgaaacccaccaactcctacagttg
agacgatttgctcatggaacagcaggtctggtgttccttacggccctctcaggggctttt
gtggcagggctagatgctgggcttgtttataactcctttcccaaaatgggagaatcctgg
atcccggaggacctctttaccttctcccccatcctgaggaatgtttttgagaatcccacc
atggtgcagtttgatcaccggattctgggaatcacttcagtcactgccattacagtgctc
tacttcctctctcggagaattccccttcctagaaggaccaagatggcagcagtgactctg
ctggctttggcgtatacacagggccctgtcttattcaactttacttttaaaatcagtgat
ttggatgaaggcatcagaaacatctga

DBGET integrated database retrieval system