KEGG   Homo sapiens (human): 1356Help
Entry
1356              CDS       T01001                                 

Gene name
CP, CP-2
Definition
(RefSeq) ceruloplasmin
  KO
K13624  
ceruloplasmin [EC:1.16.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
Porphyrin and chlorophyll metabolism
Disease
H00833  
Neurodegeneration with brain iron accumulation (NBIA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    1356 (CP)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.1  ferroxidase
     1356 (CP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   1356 (CP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P00450(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
3q24-q25.1
AA seq 1065 aa AA seqDB search
MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGP
DRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFH
SHGITYYKEHEGAIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYH
SHIDAPKDIASGLIGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYC
SEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH
GQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKS
SSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY
KKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGV
RFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYY
SAVDPTKDIFTGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF
TTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLTMCKGDSVVWYLFSAGNEADVHGIYF
SGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRR
QSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYK
KVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ
TESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVC
RRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHA
INGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFP
GTYQTLEMFPRTPGIWLLHCHVTDHIHAGMETTYTVLQNEDTKSG
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttgatacttggtatttttctgtttttatgtagtaccccagcctgggcgaaa
gaaaagcattattacattggaattattgaaacgacttgggattatgcctctgaccatggg
gaaaagaaacttatttctgttgacacggaacattccaatatctatcttcaaaatggccca
gatagaattgggagactatataagaaggccctttatcttcagtacacagatgaaaccttt
aggacaactatagaaaaaccggtctggcttgggtttttaggccctattatcaaagctgaa
actggagataaagtttatgtacacttaaaaaaccttgcctctaggccctacacctttcat
tcacatggaataacttactataaggaacatgagggggccatctaccctgataacaccaca
gattttcaaagagcagatgacaaagtatatccaggagagcagtatacatacatgttgctt
gccactgaagaacaaagtcctggggaaggagatggcaattgtgtgactaggatttaccat
tcccacattgatgctccaaaagatattgcctcaggactcatcggacctttaataatctgt
aaaaaagattctctagataaagaaaaagaaaaacatattgaccgagaatttgtggtgatg
ttttctgtggtggatgaaaatttcagctggtacctagaagacaacattaaaacctactgc
tcagaaccagagaaagttgacaaagacaacgaagacttccaggagagtaacagaatgtat
tctgtgaatggatacacttttggaagtctcccaggactctccatgtgtgctgaagacaga
gtaaaatggtacctttttggtatgggtaatgaagttgatgtgcacgcagctttctttcac
gggcaagcactgactaacaagaactaccgtattgacacaatcaacctctttcctgctacc
ctgtttgatgcttatatggtggcccagaaccctggagaatggatgctcagctgtcagaat
ctaaaccatctgaaagccggtttgcaagcctttttccaggtccaggagtgtaacaagtct
tcatcaaaggataatatccgtgggaagcatgttagacactactacattgccgctgaggaa
atcatctggaactatgctccctctggtatagacatcttcactaaagaaaacttaacagca
cctggaagtgactcagcggtgttttttgaacaaggtaccacaagaattggaggctcttat
aaaaagctggtttatcgtgagtacacagatgcctccttcacaaatcgaaaggagagaggc
cctgaagaagagcatcttggcatcctgggtcctgtcatttgggcagaggtgggagacacc
atcagagtaaccttccataacaaaggagcatatcccctcagtattgagccgattggggtg
agattcaataagaacaacgagggcacatactattccccaaattacaacccccagagcaga
agtgtgcctccttcagcctcccatgtggcacccacagaaacattcacctatgaatggact
gtccccaaagaagtaggacccactaatgcagatcctgtgtgtctagctaagatgtattat
tctgctgtggatcccactaaagatatattcactgggcttattgggccaatgaaaatatgc
aagaaaggaagtttacatgcaaatgggagacagaaagatgtagacaaggaattctatttg
tttcctacagtatttgatgagaatgagagtttactcctggaagataatattagaatgttt
acaactgcacctgatcaggtggataaggaagatgaagactttcaggaatctaataaaatg
cactccatgaatggattcatgtatgggaatcagccgggtctcactatgtgcaaaggagat
tcggtcgtgtggtacttattcagcgccggaaatgaggccgatgtacatggaatatacttt
tcaggaaacacatatctgtggagaggagaacggagagacacagcaaacctcttccctcaa
acaagtcttacgctccacatgtggcctgacacagaggggacttttaatgttgaatgcctt
acaactgatcattacacaggcggcatgaagcaaaaatatactgtgaaccaatgcaggcgg
cagtctgaggattccaccttctacctgggagagaggacatactatatcgcagcagtggag
gtggaatgggattattccccacaaagggagtgggaaaaggagctgcatcatttacaagag
cagaatgtttcaaatgcatttttagataagggagagttttacataggctcaaagtacaag
aaagttgtgtatcggcagtatactgatagcacattccgtgttccagtggagagaaaagct
gaagaagaacatctgggaattctaggtccacaacttcatgcagatgttggagacaaagtc
aaaattatctttaaaaacatggccacaaggccctactcaatacatgcccatggggtacaa
acagagagttctacagttactccaacattaccaggtgaaactctcacttacgtatggaaa
atcccagaaagatctggagctggaacagaggattctgcttgtattccatgggcttattat
tcaactgtggatcaagttaaggacctctacagtggattaattggccccctgattgtttgt
cgaagaccttacttgaaagtattcaatcccagaaggaaactggaatttgcccttctgttt
ctagtttttgatgagaatgaatcttggtacttagatgacaacatcaaaacatactctgat
caccccgagaaagtaaacaaagatgatgaggaattcatagaaagcaataaaatgcatgct
attaatggaagaatgtttggaaacctacaaggcctcacaatgcacgtgggagatgaagtc
aactggtatctgatgggaatgggcaatgaaatagacttacacactgtacattttcacggc
catagcttccaatacaagcacaggggagtttatagttctgatgtctttgacattttccct
ggaacataccaaaccctagaaatgtttccaagaacacctggaatttggttactccactgc
catgtgaccgaccacattcatgctggaatggaaaccacttacaccgttctacaaaatgaa
gacaccaaatctggctga

DBGET integrated database retrieval system