KEGG   Homo sapiens (human): 1358Help
Entry
1358              CDS       T01001                                 

Gene name
CPA2
Definition
carboxypeptidase A2 (pancreatic) (EC:3.4.17.15)
Orthology
K01298  
carboxypeptidase A2 [EC:3.4.17.15]
Organism
hsa  Homo sapiens (human)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    1358 (CPA2)
   04974 Protein digestion and absorption
    1358 (CPA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.15  carboxypeptidase A2
     1358 (CPA2)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   1358 (CPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q32
AA seq 419 aa AA seqDB search
MAMRLILFFGALFGHIYCLETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTT
PGETAHVRVPFVNVQAVKVFLESQGIAYSIMIEDVQVLLDKENEEMLFNRRRERSGNFNF
GAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHA
REWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDGYVFSQTKNRMWRKTR
SKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVDFIKSHGKVK
AFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQA
SGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRDHPY
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaggttgatcctgttttttggtgccctttttgggcatatctactgtctagaa
acatttgtgggagaccaagttcttgagattgtaccaagcaatgaagaacaaattaaaaat
ctgctacaattggaggctcaagaacatctccagcttgatttttggaaatcacccaccacc
ccaggggagacagcccacgtccgagttcccttcgtcaacgtccaggcagtcaaagtgttc
ttggagtcccagggaattgcctattccatcatgattgaagacgtgcaggtcctgttggac
aaagagaatgaagaaatgctttttaataggagaagagaacggagtggtaacttcaatttt
ggggcctaccataccctggaagagatttcccaagaaatggataacctcgtggctgagcac
cctggtctagtgagcaaagtgaatattggctcttcttttgagaaccggcctatgaacgtg
ctcaagttcagcaccggaggagacaagccagctatctggctggatgctgggatccatgct
cgagagtgggttacacaagctacggcactttggacagcaaataagattgtttctgattat
ggaaaggacccatccatcacttccattctggatgccctggatatcttcctcctgccagtc
acaaaccctgatggatacgtgttctctcaaaccaaaaatcgtatgtggcggaagacccgg
tccaaggtatctggaagcctctgtgttggtgtggatcctaaccggaactgggatgcaggt
tttggaggacctggagccagcagcaacccttgctctgattcataccacggacccagtgcc
aactctgaagttgaagtgaaatccatagtggacttcatcaagagtcatggaaaagtcaag
gccttcattaccctccacagctattcccagctgctgatgttcccctatgggtacaaatgt
accaagttagatgactttgatgagctgagtgaagtggcccaaaaggctgcccaatctctg
agaagcctgcatggcaccaagtacaaagtgggaccaatctgctctgtcatctaccaagcc
agtggaggaagcattgactggtcctatgattatggcatcaagtactcatttgcctttgaa
ctgagagacacagggcgctacggcttcctcttgccagcccgtcagatcctgcccacagcc
gaggagacctggcttggcttgaaggcaatcatggagcatgtgcgagaccacccctattag

DBGET integrated database retrieval system