KEGG   Homo sapiens (human): 135941Help
Entry
135941            CDS       T01001                                 

Gene name
OR2A14, OR2A14P, OR2A6, OST182
Definition
olfactory receptor, family 2, subfamily A, member 14
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q35
AA seq 310 aa AA seqDB search
MEGNKTWITDITLPRFQVGPALEILLCGLFSAFYTLTLLGNGVIFGIICLDCKLHTPMYF
FLSHLAIVDISYASNYVPKMLTNLMNQESTISFFPCIMQTFLYLAFAHVECLILVVMSYD
RYADICHPLRYNSLMSWRVCTVLAVASWVFSFLLALVPLVLILSLPFCGPHEINHFFCEI
LSVLKLACADTWLNQVVIFAACVFILVGPLCLVLVSYLRILAAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVTYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGAL
RRALRKERLT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcaacaagacatggatcacagacatcaccttgccgcgattccaggttggtcca
gcactggagattctcctctgtggacttttctctgccttctatacactcaccctgctgggg
aatggggtcatctttgggattatctgcctggactgtaagcttcacacacccatgtacttc
ttcctctcacacctggccattgttgacatatcctatgcttccaactatgtccccaagatg
ctgacgaatcttatgaaccaggaaagcaccatctccttttttccatgcataatgcagaca
ttcttgtatttggcttttgctcacgtagagtgtctgattttggtggtgatgtcctatgat
cgctatgcggacatctgccaccccttacgttacaatagcctcatgagctggagagtgtgc
actgtcctggctgtggcttcctgggtgttcagcttcctcctggctctggtccctttagtt
ctcatcctgagcctgcccttctgcgggcctcatgaaatcaaccacttcttctgtgaaatc
ctgtctgtcctcaagttggcctgtgctgacacctggctcaaccaggtggtcatctttgca
gcctgcgtgttcatcctggtggggccactctgcctggtgctggtctcctacttgcgcatc
ctggccgccatcttgaggatccagtctggggagggccgcagaaaggccttctccacctgc
tcctcccacctttgcgtggtgggactcttctttggcagcgccattgtcacgtacatggcc
cccaagtcccgccatcctgaggagcagcagaaagttctttccctgttttacagccttttc
aatccaatgctgaaccccctgatatatagcctaaggaatgcagaggtcaagggcgccctg
aggagggcactgaggaaggagaggctgacgtga

DBGET integrated database retrieval system