KEGG   Homo sapiens (human): 135946Help
Entry
135946            CDS       T01001                                 

Gene name
OR6B1, OR7-3, OR7-9
Definition
(RefSeq) olfactory receptor family 6 subfamily B member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    135946 (OR6B1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    135946 (OR6B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 135946
NCBI-ProteinID: NP_001005281
HGNC: 8354
Ensembl: ENSG00000221813
Vega: OTTHUMG00000157765
Pharos: O95007(Tdark)
UniProt: O95007
Position
7q35
AA seq 311 aa AA seqDB search
MELENQTRVTKFILVGFPGSLSMRAAMFLIFLVAYILTVAENVIIILLVLQNRPLHKPMY
FFLANLSFLETWYISVTVPKLLFSFWSVNNSISFTLCMIQLYFFIALMCTECVLLAAMAY
DRYVAICRPLHYPTIMSHGLCFRLALGSWAIGFGISLAKIYFISCLSFCGPNVINHFFCD
ISPVLNLSCTDMSITELVDFILALVIFLFPLFITVLSYGCILATILCMPTGKQKAFSTCA
SHLVVVTIFYSAIIFMYARPRVIHAFNMNKIISIFYAIVTPSLNPFIYCLRNREVKEALK
KLAYCQASRSD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagttggagaaccagacacgagtcaccaagttcattctggtgggattccctgggagc
ttgagtatgcgggcagccatgtttctgatattccttgtggcctatattctgacagtggct
gaaaacgtgatcatcatcctattggtgctgcaaaatcggccactgcacaagcctatgtac
ttcttcctggccaacctgtccttcttggagacctggtacatctctgtgactgtgcccaag
ttactgtttagtttttggtctgtgaacaacagcatctctttcacactctgtatgatacaa
ctgtacttcttcattgctctcatgtgcacagaatgtgtgcttctggccgccatggcctat
gaccggtatgtggccatctgtcgcccactccactacccaaccataatgagccatgggctc
tgcttccgcctcgctcttggttcctgggccattggctttggcatctccctggcgaagatc
tacttcatctcctgcctcagcttctgtggtcccaatgtcatcaaccacttcttctgtgac
atctctccagtacttaatctctcctgcacagacatgtccataactgagttggtagacttt
atcctggcactggtcatcttcctattcccactctttattactgtcctgtcctacggatgc
attctggccaccatattatgcatgcccacaggaaagcagaaagcgttctccacttgtgcc
tcccatcttgtggtggtcaccattttctattcagccattattttcatgtatgctcgacct
cgagttatccatgccttcaacatgaacaaaattatttccatcttctatgccattgtcact
ccttctctcaaccctttcatttattgcctaagaaaccgagaggtcaaggaagctctgaag
aaactggcatattgccaggccagcagatctgactag

DBGET integrated database retrieval system