KEGG   Homo sapiens (human): 135946Help
Entry
135946            CDS       T01001                                 

Gene name
OR6B1, OR7-3, OR7-9
Definition
olfactory receptor, family 6, subfamily B, member 1
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q35
AA seq 311 aa AA seqDB search
MELENQTRVTKFILVGFPGSLSMRAAMFLIFLVAYILTVAENVIIILLVLQNRPLHKPMY
FFLANLSFLETWYISVTVPKLLFSFWSVNNSISFTLCMIQLYFFIALMCTECVLLAAMAY
DRYVAICRPLHYPTIMSHGLCFRLALGSWAIGFGISLAKIYFISCLSFCGPNVINHFFCD
ISPVLNLSCTDMSITELVDFILALVIFLFPLFITVLSYGCILATILCMPTGKQKAFSTCA
SHLVVVTIFYSAIIFMYARPRVIHAFNMNKIISIFYAIVTPSLNPFIYCLRNREVKEALK
KLAYCQASRSD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggagttggagaaccagacacgagtcaccaagttcattctggtgggattccctgggagc
ttgagtatgcgggcagccatgtttctgatattccttgtggcctatattctgacagtggct
gaaaacgtgatcatcatcctattggtgctgcaaaatcggccactgcacaagcctatgtac
ttcttcctggccaacctgtccttcttggagacctggtacatctctgtgactgtgcccaag
ttactgtttagtttttggtctgtgaacaacagcatctctttcacactctgtatgatacaa
ctgtacttcttcattgctctcatgtgcacagaatgtgtgcttctggccgccatggcctat
gaccggtatgtggccatctgtcgcccactccactacccaaccataatgagccatgggctc
tgcttccgcctcgctcttggttcctgggccattggctttggcatctccctggcgaagatc
tacttcatctcctgcctcagcttctgtggtcccaatgtcatcaaccacttcttctgtgac
atctctccagtacttaatctctcctgcacagacatgtccataactgagttggtagacttt
atcctggcactggtcatcttcctattcccactctttattactgtcctgtcctacggatgc
attctggccaccatattatgcatgcccacaggaaagcagaaagcgttctccacttgtgcc
tcccatcttgtggtggtcaccattttctattcagccattattttcatgtatgctcgacct
cgagttatccatgccttcaacatgaacaaaattatttccatcttctatgccattgtcact
ccttctctcaaccctttcatttattgcctaagaaaccgagaggtcaaggaagctctgaag
aaactggcatattgccaggccagcagatctgactag

DBGET integrated database retrieval system