KEGG   Homo sapiens (human): 135948Help
Entry
135948            CDS       T01001                                 

Gene name
OR2F2, OR7-1
Definition
olfactory receptor, family 2, subfamily F, member 2
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    135948 (OR2F2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    135948 (OR2F2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q35
AA seq 317 aa AA seqDB search
MEIDNQTWVREFILLGLSSDWCTQISLFSLFLVTYLMTVLGNCLIVLLIRLDSRLHTPMY
FFLTNLSLVDVSYATSVVPQLLAHFLAEHKAIPFQSCAAQLFFSLALGGIEFVLLAVMAY
DRHVAVSDRLRYSAIMHGGLCARLAITSWVSGSINSLVQTAITFQLPMCTNKFIDHISCE
LLAVVRLACVDTSSNEAAIMVSSIVLLMTPFCLVLLSYIRIISTILKIQSREGRKKAFHT
CASHLTVVALCYGTTIFTYIQPHSGPSVLQEKLISVFYAIVMPLLNPVIYSLRNKEVKGA
WHKLLEKFSGLTSKLGT
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaaatagataaccagacgtgggtgagagaatttattctccttggcttatccagtgac
tggtgcactcagatatccctgttttccctgttcttggtcacatacctcatgacagtgctg
gggaactgtctcattgtccttctgatcagactggacagccgactccacactcccatgtat
ttctttctcaccaacctctcccttgtcgatgtctcctatgccacaagcgtagtcccccag
ctgctggcacattttcttgcagaacataaagccatcccattccagagctgtgcagcccag
ttatttttctccctggccttgggtgggattgagtttgttctcctggcagtgatggcctat
gaccgccatgtggctgtgtctgaccgcctgcgatactcggccatcatgcatggagggctg
tgtgctaggttggccatcacatcctgggtcagtggctccatcaactctcttgtgcagact
gctatcacctttcagctgcccatgtgcactaacaagtttattgatcacatatcctgtgaa
ctcctagctgtggtcaggctggcttgtgtggacacctcctccaatgaggctgccatcatg
gtgtctagcattgttcttctgatgacacctttctgcctggttctgttgtcctacatccgg
atcatctccaccatcctaaagatccagtccagagaaggaagaaagaaagccttccacacg
tgtgcctctcacctcacggtggttgccctgtgctacggcacaacgattttcacttacatc
cagccccactctggtccctcagtccttcaagagaagctgatctctgtcttctatgccatt
gttatgcctctgctgaaccctgtgatttatagtctaaggaataaagaggtgaagggggcc
tggcataaactattagagaaattctctgggttaacatccaagctgggaacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system