KEGG   Homo sapiens (human): 136Help
Entry
136               CDS       T01001                                 

Gene name
ADORA2B, ADORA2
Definition
adenosine A2b receptor
Orthology
K04267  
adenosine receptor A2b
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction
Alcoholism
Drug target
Adenosine: 
Caffeine: 
Other: 
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:hsa04020]
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:hsa04270]
Human Diseases; Substance dependence; Alcoholism [PATH:hsa05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p12
AA seq 332 aa AA seqDB search
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggagacacaggacgcgctgtacgtggcgctggagctggtcatcgccgcgctt
tcggtggcgggcaacgtgctggtgtgcgccgcggtgggcacggcgaacactctgcagacg
cccaccaactacttcctggtgtccctggctgcggccgacgtggccgtggggctcttcgcc
atcccctttgccatcaccatcagcctgggcttctgcactgacttctacggctgcctcttc
ctcgcctgcttcgtgctggtgctcacgcagagctccatcttcagccttctggccgtggca
gtcgacagatacctggccatctgtgtcccgctcaggtataaaagtttggtcacggggacc
cgagcaagaggggtcattgctgtcctctgggtccttgcctttggcatcggattgactcca
ttcctggggtggaacagtaaagacagtgccaccaacaactgcacagaaccctgggatgga
accacgaatgaaagctgctgccttgtgaagtgtctctttgagaatgtggtccccatgagc
tacatggtatatttcaatttctttgggtgtgttctgcccccactgcttataatgctggtg
atctacattaagatcttcctggtggcctgcaggcagcttcagcgcactgagctgatggac
cactcgaggaccaccctccagcgggagatccatgcagccaagtcactggccatgattgtg
gggatttttgccctgtgctggttacctgtgcatgctgttaactgtgtcactcttttccag
ccagctcagggtaaaaataagcccaagtgggcaatgaatatggccattcttctgtcacat
gccaattcagttgtcaatcccattgtctatgcttaccggaaccgagacttccgctacact
tttcacaaaattatctccaggtatcttctctgccaagcagatgtcaagagtgggaatggt
caggctggggtacagcctgctctcggtgtgggcctatga

DBGET integrated database retrieval system