KEGG   Homo sapiens (human): 136Help
Entry
136               CDS       T01001                                 

Gene name
ADORA2B, ADORA2
Definition
adenosine A2b receptor
Orthology
K04267  
adenosine receptor A2b
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Vascular smooth muscle contraction
Alcoholism
Drug target
Adenosine: 
Caffeine: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    136 (ADORA2B)
   04020 Calcium signaling pathway
    136 (ADORA2B)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    136 (ADORA2B)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    136 (ADORA2B)
 Human Diseases
  Substance dependence
   05034 Alcoholism
    136 (ADORA2B)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Adenosine
    136 (ADORA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p12
AA seq 332 aa AA seqDB search
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggagacacaggacgcgctgtacgtggcgctggagctggtcatcgccgcgctt
tcggtggcgggcaacgtgctggtgtgcgccgcggtgggcacggcgaacactctgcagacg
cccaccaactacttcctggtgtccctggctgcggccgacgtggccgtggggctcttcgcc
atcccctttgccatcaccatcagcctgggcttctgcactgacttctacggctgcctcttc
ctcgcctgcttcgtgctggtgctcacgcagagctccatcttcagccttctggccgtggca
gtcgacagatacctggccatctgtgtcccgctcaggtataaaagtttggtcacggggacc
cgagcaagaggggtcattgctgtcctctgggtccttgcctttggcatcggattgactcca
ttcctggggtggaacagtaaagacagtgccaccaacaactgcacagaaccctgggatgga
accacgaatgaaagctgctgccttgtgaagtgtctctttgagaatgtggtccccatgagc
tacatggtatatttcaatttctttgggtgtgttctgcccccactgcttataatgctggtg
atctacattaagatcttcctggtggcctgcaggcagcttcagcgcactgagctgatggac
cactcgaggaccaccctccagcgggagatccatgcagccaagtcactggccatgattgtg
gggatttttgccctgtgctggttacctgtgcatgctgttaactgtgtcactcttttccag
ccagctcagggtaaaaataagcccaagtgggcaatgaatatggccattcttctgtcacat
gccaattcagttgtcaatcccattgtctatgcttaccggaaccgagacttccgctacact
tttcacaaaattatctccaggtatcttctctgccaagcagatgtcaagagtgggaatggt
caggctggggtacagcctgctctcggtgtgggcctatga

DBGET integrated database retrieval system