KEGG   Homo sapiens (human): 136319Help
Entry
136319            CDS       T01001                                 

Gene name
MTPN, GCDP, V-1
Definition
(RefSeq) myotrophin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
7q33
AA seq 118 aa AA seqDB search
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacaaggagttcatgtgggccctgaaaaacggagacttggatgaggtgaaagac
tatgtggccaagggagaagatgtcaaccggacactagaaggtggaaggaaacctcttcat
tatgcagcagattgtgggcagcttgaaatcctggaatttctgctgctgaaaggagcagat
attaatgctccagataaacatcatattactcctcttctgtctgctgtctatgagggtcat
gtttcctgtgtgaaattgcttctgtcaaagggtgctgataagactgtgaaaggcccagat
ggactgaccgcctttgaagccactgacaaccaggcaatcaaagctcttctccagtga

DBGET integrated database retrieval system