KEGG   Homo sapiens (human): 136319Help
Entry
136319            CDS       T01001                                 

Gene name
MTPN, GCDP, V-1
Definition
(RefSeq) myotrophin
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_2 Ank_5 Ank_3 Ank DUF655
Motif
Other DBs
NCBI-GeneID: 136319
NCBI-ProteinID: NP_665807
OMIM: 606484
HGNC: 15667
Ensembl: ENSG00000105887
Vega: OTTHUMG00000155627
Pharos: P58546(Tdark)
UniProt: P58546 Q69YG1
Structure
PDB: 

Jmol
Position
7q33
AA seq 118 aa AA seqDB search
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALLQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacaaggagttcatgtgggccctgaaaaacggagacttggatgaggtgaaagac
tatgtggccaagggagaagatgtcaaccggacactagaaggtggaaggaaacctcttcat
tatgcagcagattgtgggcagcttgaaatcctggaatttctgctgctgaaaggagcagat
attaatgctccagataaacatcatattactcctcttctgtctgctgtctatgagggtcat
gtttcctgtgtgaaattgcttctgtcaaagggtgctgataagactgtgaaaggcccagat
ggactgaccgcctttgaagccactgacaaccaggcaatcaaagctcttctccagtga

DBGET integrated database retrieval system