KEGG   Homo sapiens (human): 1364Help
Entry
1364              CDS       T01001                                 

Gene name
CLDN4, CPE-R, CPER, CPETR, CPETR1, WBSCR8, hCPE-R
Definition
(RefSeq) claudin 4
  KO
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Disease
H01439  
Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1364 (CLDN4)
 Cellular Processes
  Cellular community
   04530 Tight junction
    1364 (CLDN4)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    1364 (CLDN4)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    1364 (CLDN4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1364 (CLDN4)
  Exosomal proteins of colorectal cancer cells
   1364 (CLDN4)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  CLDN; claudin [KO:K06087]
   1364 (CLDN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q11.23
AA seq 209 aa AA seqDB search
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG
QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV
AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL
LCCNCPPRTDKPYSAKYSAARSAAASNYV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatggggctacaggtaatgggcatcgcgctggccgtcctgggctggctggcc
gtcatgctgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatt
gtcacctcgcagaccatctgggagggcctatggatgaactgcgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgactcgctgctggcactgccgcaggacctgcaggcggcc
cgcgccctcgtcatcatcagcatcatcgtggctgctctgggcgtgctgctgtccgtggtg
gggggcaagtgtaccaactgcctggaggatgaaagcgccaaggccaagaccatgatcgtg
gcgggcgtggtgttcctgttggccggccttatggtgatagtgccggtgtcctggacggcc
cacaacatcatccaagacttctacaatccgctggtggcctccgggcagaagcgggagatg
ggtgcctcgctctacgtcggctgggccgcctccggcctgctgctccttggcggggggctg
ctttgctgcaactgtccaccccgcacagacaagccttactccgccaagtattctgctgcc
cgctctgctgctgccagcaactacgtgtaa

DBGET integrated database retrieval system