KEGG   Homo sapiens (human): 1364Help
Entry
1364              CDS       T01001                                 

Gene name
CLDN4, CPE-R, CPER, CPETR, CPETR1, WBSCR8, hCPE-R
Definition
(RefSeq) claudin 4
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05160  Hepatitis C
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1364 (CLDN4)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    1364 (CLDN4)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    1364 (CLDN4)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    1364 (CLDN4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1364 (CLDN4)
  Exosomal proteins of colorectal cancer cells
   1364 (CLDN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37 DUF4131 Amastin
Motif
Other DBs
NCBI-GeneID: 1364
NCBI-ProteinID: NP_001296
OMIM: 602909
HGNC: 2046
Ensembl: ENSG00000189143
Vega: OTTHUMG00000023425
Pharos: O14493(Tbio)
UniProt: O14493 Q75L80
Position
7q11.23
AA seq 209 aa AA seqDB search
MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTG
QMQCKVYDSLLALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIV
AGVVFLLAGLMVIVPVSWTAHNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGL
LCCNCPPRTDKPYSAKYSAARSAAASNYV
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatggggctacaggtaatgggcatcgcgctggccgtcctgggctggctggcc
gtcatgctgtgctgcgcgctgcccatgtggcgcgtgacggccttcatcggcagcaacatt
gtcacctcgcagaccatctgggagggcctatggatgaactgcgtggtgcagagcaccggc
cagatgcagtgcaaggtgtacgactcgctgctggcactgccgcaggacctgcaggcggcc
cgcgccctcgtcatcatcagcatcatcgtggctgctctgggcgtgctgctgtccgtggtg
gggggcaagtgtaccaactgcctggaggatgaaagcgccaaggccaagaccatgatcgtg
gcgggcgtggtgttcctgttggccggccttatggtgatagtgccggtgtcctggacggcc
cacaacatcatccaagacttctacaatccgctggtggcctccgggcagaagcgggagatg
ggtgcctcgctctacgtcggctgggccgcctccggcctgctgctccttggcggggggctg
ctttgctgcaactgtccaccccgcacagacaagccttactccgccaagtattctgctgcc
cgctctgctgctgccagcaactacgtgtaa

DBGET integrated database retrieval system