KEGG   Homo sapiens (human): 137075Help
Entry
137075            CDS       T01001                                 

Gene name
CLDN23, CLDNL, hCG1646163
Definition
(RefSeq) claudin 23
  KO
K06087  
claudin
Organism
hsa  Homo sapiens (human)
Pathway
Cell adhesion molecules (CAMs)
Tight junction
Leukocyte transendothelial migration
Hepatitis C
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    137075 (CLDN23)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    137075 (CLDN23)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    137075 (CLDN23)
 Human Diseases
  Infectious diseases
   05160 Hepatitis C
    137075 (CLDN23)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   137075 (CLDN23)
  Exosomal proteins of colorectal cancer cells
   137075 (CLDN23)
Cell adhesion molecules and their ligands [BR:hsa04516]
 7. Others
  CLDN; claudin [KO:K06087]
   137075 (CLDN23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q96B33(Tbio)
UniProt: 
Position
8p23.1
AA seq 292 aa AA seqDB search
MRTPVVMTLGMVLAPCGLLLNLTGTLAPGWRLVKGFLNQPVDVELYQGLWDMCREQSSRE
RECGQTDQWGYFEAQPVLVARALMVTSLAATVLGLLLASLGVRCWQDEPNFVLAGLSGVV
LFVAGLLGLIPVSWYNHFLGDRDVLPAPASPVTVQVSYSLVLGYLGSCLLLLGGFSLALS
FAPWCDERCRRRRKGPSAGPRRSSVSTIQVEWPEPDLAPAIKYYSDGQHRPPPAQHRKPK
PKPKVGFPMPRPRPKAYTNSVDVLDGEGWESQDAPSCSTHPCDSSLPCDSDL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgccggtggtgatgacgctgggcatggtgttggcgccctgcgggctcctgctc
aacctgaccggcaccctggcgcccggctggcggctggtgaagggcttcctgaaccagcca
gtggacgtggagttgtaccagggcctgtgggacatgtgtcgcgagcagagcagccgcgag
cgcgagtgcggccagacggaccagtggggctacttcgaggcccagcccgtgctggtggcg
cgggcactcatggtcacctcgctggccgccacggtcctggggcttctgctggcgtcgctg
ggcgtgcgctgctggcaggacgagcccaacttcgtgctggcagggctctcgggcgtcgtg
ctcttcgtcgctggcctcctcggcctcatcccggtgtcctggtacaaccacttcttgggg
gaccgcgacgtgctgcccgccccggccagcccggtcacggtgcaggtcagctacagcctg
gtcctgggctacctgggcagctgcctcctgctgctgggcggcttctcgctggcgctcagc
ttcgcgccctggtgcgacgagcgttgtcgccgccgccgcaagggaccctccgccgggcct
cgccgcagcagcgtcagcaccatccaagtggagtggcccgagcccgacctggcgcccgcc
atcaagtactacagcgacggccagcaccgaccgccgcctgcccagcaccgcaagcccaag
cccaagcccaaggtcggcttccccatgccgcggccgcggcccaaggcctacaccaactcg
gtggacgtcctcgacggggaggggtgggagtcccaggacgctccctcgtgcagcacccac
ccctgcgacagctcgctgccctgcgactccgacctctag

DBGET integrated database retrieval system