KEGG   Homo sapiens (human): 1374Help
Entry
1374              CDS       T01001                                 

Gene name
CPT1A, CPT1, CPT1-L, L-CPT1
Definition
carnitine palmitoyltransferase 1A (liver) (EC:2.3.1.21)
Orthology
K08765  
carnitine O-palmitoyltransferase 1 [EC:2.3.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Adipocytokine signaling pathway
Disease
H00525  
Disorders of fatty-acid oxidation
Drug target
Perhexiline: 
Other: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    1374 (CPT1A)
  Lipid metabolism
   00071 Fatty acid degradation
    1374 (CPT1A)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    1374 (CPT1A)
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    1374 (CPT1A)
   03320 PPAR signaling pathway
    1374 (CPT1A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     1374 (CPT1A)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    1374 (CPT1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
11q13.2
AA seq 756 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPS
SWLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIV
TMRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVK
DTVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYI
YLRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGST
IPLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREME
QQMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTL
DETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPI
VAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLL
ANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREG
RTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCL
YVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGY
GVSYILVGENLINFHISSKFSCPETGIISQGPSSDT
NT seq 2271 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagctcaccaagctgtggcctttcagttcacggtcactccggacgggattgac
ctgcggctgagccatgaagctcttagacaaatctatctctctggacttcattcctggaaa
aagaagttcatcagattcaagaacggcatcatcactggcgtgtacccggcaagcccctcc
agttggcttatcgtggtggtgggcgtgatgacaacgatgtacgccaagatcgacccctcg
ttaggaataattgcaaaaatcaatcggactctggaaacggccaactgcatgtccagccag
acgaagaacgtggtcagcggcgtgctgtttggcaccggcctgtgggtggccctcatcgtc
accatgcgctactccctgaaagtgctgctctcctaccacgggtggatgttcactgagcac
ggcaagatgagtcgtgccaccaagatctggatgggtatggtcaagatcttttcaggccga
aaacccatgttgtacagcttccagacatcgctgcctcgcctgccggtcccggctgtcaaa
gacactgtgaacaggtatctacagtcggtgaggcctcttatgaaggaagaagacttcaaa
cggatgacagcacttgctcaagattttgctgtcggtcttggaccaagattacagtggtat
ttgaagttaaaatcctggtgggctacaaattacgtgagcgactggtgggaggagtacatc
tacctccgaggacgagggccgctcatggtgaacagcaactattatgccatggatctgctg
tatatccttccaactcacattcaggcagcaagagccggcaacgccatccatgccatcctg
ctttacaggcgcaaactggaccgggaggaaatcaaaccaattcgtcttttgggatccacg
attccactctgctccgctcagtgggagcggatgtttaatacttcccggatcccaggagag
gagacagacaccatccagcacatgagagacagcaagcacatcgtcgtgtaccatcgagga
cgctacttcaaggtctggctctaccatgatgggcggctgctgaagccccgggagatggag
cagcagatgcagaggatcctggacaatacctcggagcctcagcccggggaggccaggctg
gcagccctcaccgcaggagacagagttccctgggccaggtgtcgtcaggcctattttgga
cgtgggaaaaataagcagtctcttgatgctgtggagaaagcagcgttcttcgtgacgtta
gatgaaactgaagaaggatacagaagtgaagacccggatacgtcaatggacagctacgcc
aaatctctactacacggccgatgttacgacaggtggtttgacaagtcgttcacgtttgtt
gtcttcaaaaacgggaagatgggcctcaacgctgaacactcctgggcagatgcgccgatc
gtggcccacctttgggagtacgtcatgtccattgacagcctccagctgggctatgcggag
gatgggcactgcaaaggcgacatcaatccgaacattccgtaccccaccaggctgcagtgg
gacatcccgggggaatgtcaagaggttatagagacctccctgaacaccgcaaatcttctg
gcaaacgacgtggatttccattccttcccattcgtagcctttggtaaaggaatcatcaag
aaatgtcgcacgagcccagacgcctttgtgcagctggccctccagctggcgcactacaag
gacatgggcaagttttgcctcacatacgaggcctccatgacccggctcttccgagagggg
aggacggagaccgtgcgctcctgcaccactgagtcatgcgacttcgtgcgggccatggtg
gacccggcccagacggtggaacagaggctgaagttgttcaagttggcgtctgagaagcat
cagcatatgtatcgcctcgccatgaccggctctgggatcgatcgtcacctcttctgcctt
tacgtggtgtctaaatatctcgctgtggagtcccctttccttaaggaagttttatctgag
ccttggagattatcaacaagccagacccctcagcagcaagtggagctgtttgacttggag
aataacccagagtacgtgtccagcggagggggctttggaccggttgctgatgacggctat
ggtgtgtcgtacatccttgtgggagagaacctcatcaatttccacatttcttccaagttc
tcttgccctgagacggggattataagtcaaggaccaagttcagatacttga

  All links  
No link information was found.   
DBGET integrated database retrieval system