KEGG   Homo sapiens (human): 1376Help
Entry
1376              CDS       T01001                                 

Gene name
CPT2, CPT1, CPTASE, IIAE4
Definition
carnitine palmitoyltransferase 2 (EC:2.3.1.21)
Orthology
K08766  
carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
Fatty acid degradation
Fatty acid metabolism
PPAR signaling pathway
Disease
H00525  
Disorders of fatty-acid oxidation
H01400  
Secondary hyperammonemia
Drug target
Perhexiline: 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    1376 (CPT2)
  Lipid metabolism
   00071 Fatty acid degradation
    1376 (CPT2)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    1376 (CPT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     1376 (CPT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p32
AA seq 658 aa AA seqDB search
MVPRLLLRAWPRGPAVGPGAPSRPLSAGSGPGQYLQRSIVPTMHYQDSLPRLPIPKLEDT
IRRYLSAQKPLLNDGQFRKTEQFCKSFENGIGKELHEQLVALDKQNKHTSYISGPWFDMY
LSARDSVVLNFNPFMAFNPDPKSEYNDQLTRATNMTVSAIRFLKTLRAGLLEPEVFHLNP
AKSDTITFKRLIRFVPSSLSWYGAYLVNAYPLDMSQYFRLFNSTRLPKPSRDELFTDDKA
RHLLVLRKGNFYIFDVLDQDGNIVSPSEIQAHLKYILSDSSPAPEFPLAYLTSENRDIWA
ELRQKLMSSGNEESLRKVDSAVFCLCLDDFPIKDLVHLSHNMLHGDGTNRWFDKSFNLII
AKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELT
DALKTGITAAKEKFDATMKTLTIDCVQFQRGGKEFLKKQKLSPDAVAQLAFQMAFLRQYG
QTVATYESCSTAAFKHGRTETIRPASVYTKRCSEAFVREPSRHSAGELQQMMVECSKYHG
QLTKEAAMGQGFDRHLFALRHLAAAKGIILPELYLDPAYGQINHNVLSTSTLSSPAVNLG
GFAPVVSDGFGVGYAVHDNWIGCNVSSYPGRNAREFLQCVEKALEDMFDALEGKSIKS
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atggtgccccgcctgctgctgcgcgcctggccccggggccccgcggttggtccgggagcc
cccagtcggcccctcagcgccggctccgggcccggccagtacctgcagcgcagcatcgtg
cccaccatgcactaccaggacagcctgcccaggctgcctattcccaaacttgaagacacc
attaggagatacctcagtgcacagaagcctctcttgaatgatggccagttcaggaaaaca
gaacaattttgcaagagttttgaaaatgggattggaaaagaactgcatgagcagctggtt
gctctggacaaacagaataaacatacaagctacatttcgggaccctggtttgatatgtac
ctatctgctcgagactccgttgttctgaactttaatccatttatggctttcaatcctgac
ccaaaatctgagtataatgaccagctcacccgggcaaccaacatgactgtttctgccatc
cggtttctgaagacactccgggctggccttctggagccagaagtgttccacttgaaccct
gcaaaaagtgacactatcaccttcaagagactcatacgctttgtgccttcctctctgtcc
tggtatggggcctacctggtcaatgcgtatcccctggatatgtcccagtattttcggctt
ttcaactcaactcgtttacccaaacccagtcgggatgaactcttcactgatgacaaggcc
agacacctcctggtcctaaggaaaggaaatttttatatctttgatgtcctggatcaagat
gggaacattgtgagcccctcggaaatccaggcacatctgaagtacattctctcagacagc
agccccgcccccgagtttcccctggcatacctgaccagtgagaaccgagacatctgggca
gagctcaggcagaagctgatgagtagtggcaatgaggagagcctgaggaaagtggactcg
gcagtgttctgtctctgcctagatgacttccccattaaggaccttgtccacttgtcccac
aatatgctgcatggggatggcacaaaccgctggtttgataaatcctttaacctcattatc
gccaaggatggctctactgccgtccactttgagcactcttggggtgatggtgtggcagtg
ctcagattttttaatgaagtatttaaagacagcactcagacccctgccgtcactccacag
agccagccagctaccactgactctactgtcacggtgcagaaactcaacttcgagctgact
gatgccttaaagactggcatcacagctgctaaggaaaagtttgatgccaccatgaaaacc
ctcactattgactgcgtccagtttcagagaggaggcaaagaattcctgaagaagcaaaag
ctgagccctgacgcagttgcccagctggcattccagatggccttcctgcggcagtacggg
cagacagtggccacctacgagtcctgtagcactgccgcattcaagcacggccgcactgag
accatccgcccggcctccgtctatacaaagaggtgctctgaggcctttgtcagggagccc
tccaggcacagtgctggtgagcttcagcagatgatggttgagtgctccaagtaccatggc
cagctgaccaaagaagcagcaatgggccagggctttgaccgacacttgtttgctctgcgg
catctggcagcagccaaagggatcatcttgcctgagctctacctggaccctgcatacggg
cagataaaccacaatgtcctgtccacgagcacactgagcagcccagcagtgaaccttggg
ggctttgcccctgtggtctctgatggctttggtgttgggtatgctgttcatgacaactgg
ataggctgcaatgtctcttcctacccaggccgcaatgcccgggagtttctccaatgtgtg
gagaaggccttagaagacatgtttgatgccttagaaggcaaatccatcaaaagttaa

DBGET integrated database retrieval system