KEGG   Homo sapiens (human): 137735Help
Entry
137735            CDS       T01001                                 

Gene name
ABRA, STARS
Definition
(RefSeq) actin binding Rho activating protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8q23.1
AA seq 381 aa AA seqDB search
MAPGEKESGEGPAKSALRKIRTATLVISLARGWQQWANENSIRQAQEPTGWLPGGTQDSP
QAPKPITPPTSHQKAQSAPKSPPRLPEGHGDGQSSEKAPEVSHIKKKEVSKTVVSKTYER
GGDVSHLSHRYERDAGVLEPGQPENDIDRILHSHGSPTRRRKCANLVSELTKGWRVMEQE
EPTWRSDSVDTEDSGYGGEAEERPEQDGVQVAVVRIKRPLPSQVNRFTEKLNCKAQQKYS
PVGNLKGRWQQWADEHIQSQKLNPFSEEFDYELAMSTRLHKGDEGYGRPKEGTKTAERAK
RAEEHIYREMMDMCFIICTMARHRRDGKIQVTFGDLFDRYVRISDKVVGILMRARKHGLV
DFEGEMLWQGRDDHVVITLLK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggctccgggcgaaaaggaaagcggggagggcccagccaagagcgccctccggaagata
cgcacagccaccctggtcatcagcttggcccgaggttggcagcagtgggcgaatgagaac
agcatcaggcaggcccaggagcctacaggctggctgccgggagggacccaggactcacct
caagctcctaaaccaatcacaccccctacttcacaccagaaagctcagagtgccccaaag
tcgccaccccgcctgccagaaggacatggagatggacaaagctcagagaaagcccctgag
gtttctcacatcaaaaagaaagaggtgtccaaaacggtggtcagcaagacttatgagaga
ggaggggacgtgagccacctcagccacaggtacgagagggatgctggtgtgcttgaacct
gggcagccagagaatgacattgacagaatcctccacagccacggctccccaacgcggagg
agaaaatgtgccaacctggtgtctgagctaaccaagggctggagagtgatggagcaggag
gagcccacatggaggagtgacagcgtagacacagaggacagcggctatggaggagaggct
gaggagaggcccgagcaggatggagtgcaggtggctgtggtcaggatcaagcgccccttg
ccctcccaggtaaacagatttacagagaaactcaactgcaaagcccaacagaaatatagc
ccagtgggcaacttgaaagggagatggcagcagtgggctgatgaacacatacaatcccag
aagctcaatcctttcagtgaagagtttgattacgagctggccatgtccacccgcctacac
aaaggagatgagggctatggccgccccaaagaaggaaccaaaactgctgaaagggccaag
cgtgctgaggagcacatctacagggaaatgatggacatgtgcttcattatctgcacaatg
gctcgccacagacgagatggcaagatccaggttacttttggagatctctttgacagatac
gttcgtatttcagataaagtagtgggcattctcatgcgtgccaggaaacatggactggta
gactttgaaggagagatgctatggcaaggccgagatgaccatgttgtgattacgctactc
aagtga

DBGET integrated database retrieval system