KEGG   Homo sapiens (human): 1378Help
Entry
1378              CDS       T01001                                 

Gene name
CR1, C3BR, C4BR, CD35, KN
Definition
complement component (3b/4b) receptor 1 (Knops blood group)
Orthology
K04011  
complement component (3b/4b) receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Hematopoietic cell lineage
Legionellosis
Leishmaniasis
Malaria
Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    1378 (CR1)
   04610 Complement and coagulation cascades
    1378 (CR1)
 Human Diseases
  Infectious diseases
   05134 Legionellosis
    1378 (CR1)
   05152 Tuberculosis
    1378 (CR1)
   05144 Malaria
    1378 (CR1)
   05140 Leishmaniasis
    1378 (CR1)
Cellular antigens [BR:hsa04090]
 Proteins
  1378 (CR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 2039 aa AA seqDB search
MGASSPRSPEPVGPPAPGLPFCCGGSLLAVVVLLALPVAWGQCNAPEWLPFARPTNLTDE
FEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKG
IQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFIST
NRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTP
PNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPP
PDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGAASMRCTPQGDWSPAAPTCEVKSCDD
FMGQLLNGRVLFPVNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIF
CPSPPVIPNGRHTGKPLEVFPFGKTVNYTCDPHPDRGTSFDLIGESTIRCTSDPQGNGVW
SSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNL
VWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGN
AAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGE
PSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGF
VMKGPRRVKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGY
DLRGAASMRCTPQGDWSPAAPTCEVKSCDDFMGQLLNGRVLFPVNLQLGAKVDFVCDEGF
QLKGSSASYCVLAGMESLWNSSVPVCEQIFCPSPPVIPNGRHTGKPLEVFPFGKAVNYTC
DPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNA
SDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITD
IQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFIST
NRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTP
PNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPP
PEILHGEHTPSHQDNFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAPRCAVKSCDD
FLGQLPHGRVLFPLNLQLGAKVSFVCDEGFRLKGSSVSHCVLVGMRSLWNNSVPVCEHIF
CPNPPAILNGRHTGTPSGDIPYGKEISYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVW
SSPAPRCELSVRAGHCKTPEQFPFASPTIPINDFEFPVGTSLNYECRPGYFGKMFSISCL
ENLVWSSVEDNCRRKSCGPPPEPFNGMVHINTDTQFGSTVNYSCNEGFRLIGSPSTTCLV
SGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQLFEL
VGERSIYCTSKDDQVGVWSSPPPRCISTNKCTAPEVENAIRVPGNRSFFTLTEIIRFRCQ
PGFVMVGSHTVQCQTNGRWGPKLPHCSRVCQPPPEILHGEHTLSHQDNFSPGQEVFYSCE
PSYDLRGAASLHCTPQGDWSPEAPRCTVKSCDDFLGQLPHGRVLLPLNLQLGAKVSFVCD
EGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEIS
YACDTHPDRGMTFNLIGESSIRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYI
GGHVSLYLPGMTISYICDPGYLLVGKGFIFCTDQGIWSQLDHYCKEVNCSFPLFMNGISK
ELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSG
TIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP
NT seq 6120 nt NT seq  +upstreamnt  +downstreamnt
atgggggcctcttctccaagaagcccggagcctgtcgggccgccggcgcccggtctcccc
ttctgctgcggaggatccctgctggcggttgtggtgctgcttgcgctgccggtggcctgg
ggtcaatgcaatgccccagaatggcttccatttgccaggcctaccaacctaactgatgaa
tttgagtttcccattgggacatatctgaactatgaatgccgccctggttattccggaaga
ccgttttctatcatctgcctaaaaaactcagtctggactggtgctaaggacaggtgcaga
cgtaaatcatgtcgtaatcctccagatcctgtgaatggcatggtgcatgtgatcaaaggc
atccagttcggatcccaaattaaatattcttgtactaaaggataccgactcattggttcc
tcgtctgccacatgcatcatctcaggtgatactgtcatttgggataatgaaacacctatt
tgtgacagaattccttgtgggctaccccccaccatcaccaatggagatttcattagcacc
aacagagagaattttcactatggatcagtggtgacctaccgctgcaatcctggaagcgga
gggagaaaggtgtttgagcttgtgggtgagccctccatatactgcaccagcaatgacgat
caagtgggcatctggagcggccccgcccctcagtgcattatacctaacaaatgcacgcct
ccaaatgtggaaaatggaatattggtatctgacaacagaagcttattttccttaaatgaa
gttgtggagtttaggtgtcagcctggctttgtcatgaaaggaccccgccgtgtgaagtgc
caggccctgaacaaatgggagccggagctaccaagctgctccagggtatgtcagccacct
ccagatgtcctgcatgctgagcgtacccaaagggacaaggacaacttttcacctgggcag
gaagtgttctacagctgtgagcccggctacgacctcagaggggctgcgtctatgcgctgc
acaccccagggagactggagccctgcagcccccacatgtgaagtgaaatcctgtgatgac
ttcatgggccaacttcttaatggccgtgtgctatttccagtaaatctccagcttggagca
aaagtggattttgtttgtgatgaaggatttcaattaaaaggcagctctgctagttactgt
gtcttggctggaatggaaagcctttggaatagcagtgttccagtgtgtgaacaaatcttt
tgtccaagtcctccagttattcctaatgggagacacacaggaaaacctctggaagtcttt
ccctttgggaaaacagtaaattacacatgcgacccccacccagacagagggacgagcttc
gacctcattggagagagcaccatccgctgcacaagtgaccctcaagggaatggggtttgg
agcagccctgcccctcgctgtggaattctgggtcactgtcaagccccagatcattttctg
tttgccaagttgaaaacccaaaccaatgcatctgactttcccattgggacatctttaaag
tacgaatgccgtcctgagtactacgggaggccattctctatcacatgtctagataacctg
gtctggtcaagtcccaaagatgtctgtaaacgtaaatcatgtaaaactcctccagatcca
gtgaatggcatggtgcatgtgatcacagacatccaggttggatccagaatcaactattct
tgtactacagggcaccgactcattggtcactcatctgctgaatgtatcctctcgggcaat
gctgcccattggagcacgaagccgccaatttgtcaacgaattccttgtgggctacccccc
accatcgccaatggagatttcattagcaccaacagagagaattttcactatggatcagtg
gtgacctaccgctgcaatcctggaagcggagggagaaaggtgtttgagcttgtgggtgag
ccctccatatactgcaccagcaatgacgatcaagtgggcatctggagcggcccggcccct
cagtgcattatacctaacaaatgcacgcctccaaatgtggaaaatggaatattggtatct
gacaacagaagcttattttccttaaatgaagttgtggagtttaggtgtcagcctggcttt
gtcatgaaaggaccccgccgtgtgaagtgccaggccctgaacaaatgggagccggagcta
ccaagctgctccagggtatgtcagccacctccagatgtcctgcatgctgagcgtacccaa
agggacaaggacaacttttcacccgggcaggaagtgttctacagctgtgagcccggctat
gacctcagaggggctgcgtctatgcgctgcacaccccagggagactggagccctgcagcc
cccacatgtgaagtgaaatcctgtgatgacttcatgggccaacttcttaatggccgtgtg
ctatttccagtaaatctccagcttggagcaaaagtggattttgtttgtgatgaaggattt
caattaaaaggcagctctgctagttattgtgtcttggctggaatggaaagcctttggaat
agcagtgttccagtgtgtgaacaaatcttttgtccaagtcctccagttattcctaatggg
agacacacaggaaaacctctggaagtctttccctttggaaaagcagtaaattacacatgc
gacccccacccagacagagggacgagcttcgacctcattggagagagcaccatccgctgc
acaagtgaccctcaagggaatggggtttggagcagccctgcccctcgctgtggaattctg
ggtcactgtcaagccccagatcattttctgtttgccaagttgaaaacccaaaccaatgca
tctgactttcccattgggacatctttaaagtacgaatgccgtcctgagtactacgggagg
ccattctctatcacatgtctagataacctggtctggtcaagtcccaaagatgtctgtaaa
cgtaaatcatgtaaaactcctccagatccagtgaatggcatggtgcatgtgatcacagac
atccaggttggatccagaatcaactattcttgtactacagggcaccgactcattggtcac
tcatctgctgaatgtatcctctcaggcaatactgcccattggagcacgaagccgccaatt
tgtcaacgaattccttgtgggctacccccaaccatcgccaatggagatttcattagcacc
aacagagagaattttcactatggatcagtggtgacctaccgctgcaatcttggaagcaga
gggagaaaggtgtttgagcttgtgggtgagccctccatatactgcaccagcaatgacgat
caagtgggcatctggagcggccccgcccctcagtgcattatacctaacaaatgcacgcct
ccaaatgtggaaaatggaatattggtatctgacaacagaagcttattttccttaaatgaa
gttgtggagtttaggtgtcagcctggctttgtcatgaaaggaccccgccgtgtgaagtgc
caggccctgaacaaatgggagccagagttaccaagctgctccagggtgtgtcagccgcct
ccagaaatcctgcatggtgagcataccccaagccatcaggacaacttttcacctgggcag
gaagtgttctacagctgtgagcctggctatgacctcagaggggctgcgtctctgcactgc
acaccccagggagactggagccctgaagccccgagatgtgcagtgaaatcctgtgatgac
ttcttgggtcaactccctcatggccgtgtgctatttccacttaatctccagcttggggca
aaggtgtcctttgtctgtgatgaagggtttcgcttaaagggcagttccgttagtcattgt
gtcttggttggaatgagaagcctttggaataacagtgttcctgtgtgtgaacatatcttt
tgtccaaatcctccagctatccttaatgggagacacacaggaactccctctggagatatt
ccctatggaaaagaaatatcttacacatgtgacccccacccagacagagggatgaccttc
aacctcattggggagagcaccatccgctgcacaagtgaccctcatgggaatggggtttgg
agcagccctgcccctcgctgtgaactttctgttcgtgctggtcactgtaaaaccccagag
cagtttccatttgccagtcctacgatcccaattaatgactttgagtttccagtcgggaca
tctttgaattatgaatgccgtcctgggtattttgggaaaatgttctctatctcctgccta
gaaaacttggtctggtcaagtgttgaagacaactgtagacgaaaatcatgtggacctcca
ccagaacccttcaatggaatggtgcatataaacacagatacacagtttggatcaacagtt
aattattcttgtaatgaagggtttcgactcattggttccccatctactacttgtctcgtc
tcaggcaataatgtcacatgggataagaaggcacctatttgtgagatcatatcttgtgag
ccacctccaaccatatccaatggagacttctacagcaacaatagaacatcttttcacaat
ggaacggtggtaacttaccagtgccacactggaccagatggagaacagctgtttgagctt
gtgggagaacggtcaatatattgcaccagcaaagatgatcaagttggtgtttggagcagc
cctccccctcggtgtatttctactaataaatgcacagctccagaagttgaaaatgcaatt
agagtaccaggaaacaggagtttctttaccctcactgagatcatcagatttagatgtcag
cccgggtttgtcatggtagggtcccacactgtgcagtgccagaccaatggcagatggggg
cccaagctgccacactgctccagggtgtgtcagccgcctccagaaatcctgcatggtgag
cataccctaagccatcaggacaacttttcacctgggcaggaagtgttctacagctgtgag
cccagctatgacctcagaggggctgcgtctctgcactgcacgccccagggagactggagc
cctgaagcccctagatgtacagtgaaatcctgtgatgacttcctgggccaactccctcat
ggccgtgtgctacttccacttaatctccagcttggggcaaaggtgtcctttgtttgcgat
gaagggttccgattaaaaggcaggtctgctagtcattgtgtcttggctggaatgaaagcc
ctttggaatagcagtgttccagtgtgtgaacaaatcttttgtccaaatcctccagctatc
cttaatgggagacacacaggaactccctttggagatattccctatggaaaagaaatatct
tacgcatgcgacacccacccagacagagggatgaccttcaacctcattggggagagctcc
atccgctgcacaagtgaccctcaagggaatggggtttggagcagccctgcccctcgctgt
gaactttctgttcctgctgcctgcccacatccacccaagatccaaaacgggcattacatt
ggaggacacgtatctctatatcttcctgggatgacaatcagctacatttgtgaccccggc
tacctgttagtgggaaagggcttcattttctgtacagaccagggaatctggagccaattg
gatcattattgcaaagaagtaaattgtagcttcccactgtttatgaatggaatctcgaag
gagttagaaatgaaaaaagtatatcactatggagattatgtgactttgaagtgtgaagat
gggtatactctggaaggcagtccctggagccagtgccaggcggatgacagatgggaccct
cctctggccaaatgtacctctcgtacacatgatgctctcatagttggcactttatctggt
acgatcttctttattttactcatcattttcctctcttggataattctaaagcacagaaaa
ggcaataatgcacatgaaaaccctaaagaagtggctatccatttacattctcaaggaggc
agcagcgttcatccccgaactctgcaaacaaatgaagaaaatagcagggtccttccttga

DBGET integrated database retrieval system