KEGG   Homo sapiens (human): 1378Help
Entry
1378              CDS       T01001                                 

Gene name
CR1, C3BR, C4BR, CD35, KN
Definition
complement component (3b/4b) receptor 1 (Knops blood group)
Orthology
K04011  
complement component (3b/4b) receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Hematopoietic cell lineage
Legionellosis
Leishmaniasis
Malaria
Tuberculosis
Class
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:hsa04640]
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Infectious diseases; Legionellosis [PATH:hsa05134]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
Human Diseases; Infectious diseases; Malaria [PATH:hsa05144]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:hsa05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q32
AA seq 2039 aa AA seqDB search
MGASSPRSPEPVGPPAPGLPFCCGGSLLAVVVLLALPVAWGQCNAPEWLPFARPTNLTDE
FEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKG
IQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFIST
NRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTP
PNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPP
PDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGAASMRCTPQGDWSPAAPTCEVKSCDD
FMGQLLNGRVLFPVNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIF
CPSPPVIPNGRHTGKPLEVFPFGKTVNYTCDPHPDRGTSFDLIGESTIRCTSDPQGNGVW
SSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNL
VWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGN
AAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGE
PSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGF
VMKGPRRVKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGY
DLRGAASMRCTPQGDWSPAAPTCEVKSCDDFMGQLLNGRVLFPVNLQLGAKVDFVCDEGF
QLKGSSASYCVLAGMESLWNSSVPVCEQIFCPSPPVIPNGRHTGKPLEVFPFGKAVNYTC
DPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNA
SDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITD
IQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFIST
NRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTP
PNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPP
PEILHGEHTPSHQDNFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAPRCAVKSCDD
FLGQLPHGRVLFPLNLQLGAKVSFVCDEGFRLKGSSVSHCVLVGMRSLWNNSVPVCEHIF
CPNPPAILNGRHTGTPSGDIPYGKEISYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVW
SSPAPRCELSVRAGHCKTPEQFPFASPTIPINDFEFPVGTSLNYECRPGYFGKMFSISCL
ENLVWSSVEDNCRRKSCGPPPEPFNGMVHINTDTQFGSTVNYSCNEGFRLIGSPSTTCLV
SGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQLFEL
VGERSIYCTSKDDQVGVWSSPPPRCISTNKCTAPEVENAIRVPGNRSFFTLTEIIRFRCQ
PGFVMVGSHTVQCQTNGRWGPKLPHCSRVCQPPPEILHGEHTLSHQDNFSPGQEVFYSCE
PSYDLRGAASLHCTPQGDWSPEAPRCTVKSCDDFLGQLPHGRVLLPLNLQLGAKVSFVCD
EGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEIS
YACDTHPDRGMTFNLIGESSIRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYI
GGHVSLYLPGMTISYICDPGYLLVGKGFIFCTDQGIWSQLDHYCKEVNCSFPLFMNGISK
ELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSG
TIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP
NT seq 6120 nt NT seq  +upstreamnt  +downstreamnt
atgggggcctcttctccaagaagcccggagcctgtcgggccgccggcgcccggtctcccc
ttctgctgcggaggatccctgctggcggttgtggtgctgcttgcgctgccggtggcctgg
ggtcaatgcaatgccccagaatggcttccatttgccaggcctaccaacctaactgatgaa
tttgagtttcccattgggacatatctgaactatgaatgccgccctggttattccggaaga
ccgttttctatcatctgcctaaaaaactcagtctggactggtgctaaggacaggtgcaga
cgtaaatcatgtcgtaatcctccagatcctgtgaatggcatggtgcatgtgatcaaaggc
atccagttcggatcccaaattaaatattcttgtactaaaggataccgactcattggttcc
tcgtctgccacatgcatcatctcaggtgatactgtcatttgggataatgaaacacctatt
tgtgacagaattccttgtgggctaccccccaccatcaccaatggagatttcattagcacc
aacagagagaattttcactatggatcagtggtgacctaccgctgcaatcctggaagcgga
gggagaaaggtgtttgagcttgtgggtgagccctccatatactgcaccagcaatgacgat
caagtgggcatctggagcggccccgcccctcagtgcattatacctaacaaatgcacgcct
ccaaatgtggaaaatggaatattggtatctgacaacagaagcttattttccttaaatgaa
gttgtggagtttaggtgtcagcctggctttgtcatgaaaggaccccgccgtgtgaagtgc
caggccctgaacaaatgggagccggagctaccaagctgctccagggtatgtcagccacct
ccagatgtcctgcatgctgagcgtacccaaagggacaaggacaacttttcacctgggcag
gaagtgttctacagctgtgagcccggctacgacctcagaggggctgcgtctatgcgctgc
acaccccagggagactggagccctgcagcccccacatgtgaagtgaaatcctgtgatgac
ttcatgggccaacttcttaatggccgtgtgctatttccagtaaatctccagcttggagca
aaagtggattttgtttgtgatgaaggatttcaattaaaaggcagctctgctagttactgt
gtcttggctggaatggaaagcctttggaatagcagtgttccagtgtgtgaacaaatcttt
tgtccaagtcctccagttattcctaatgggagacacacaggaaaacctctggaagtcttt
ccctttgggaaaacagtaaattacacatgcgacccccacccagacagagggacgagcttc
gacctcattggagagagcaccatccgctgcacaagtgaccctcaagggaatggggtttgg
agcagccctgcccctcgctgtggaattctgggtcactgtcaagccccagatcattttctg
tttgccaagttgaaaacccaaaccaatgcatctgactttcccattgggacatctttaaag
tacgaatgccgtcctgagtactacgggaggccattctctatcacatgtctagataacctg
gtctggtcaagtcccaaagatgtctgtaaacgtaaatcatgtaaaactcctccagatcca
gtgaatggcatggtgcatgtgatcacagacatccaggttggatccagaatcaactattct
tgtactacagggcaccgactcattggtcactcatctgctgaatgtatcctctcgggcaat
gctgcccattggagcacgaagccgccaatttgtcaacgaattccttgtgggctacccccc
accatcgccaatggagatttcattagcaccaacagagagaattttcactatggatcagtg
gtgacctaccgctgcaatcctggaagcggagggagaaaggtgtttgagcttgtgggtgag
ccctccatatactgcaccagcaatgacgatcaagtgggcatctggagcggcccggcccct
cagtgcattatacctaacaaatgcacgcctccaaatgtggaaaatggaatattggtatct
gacaacagaagcttattttccttaaatgaagttgtggagtttaggtgtcagcctggcttt
gtcatgaaaggaccccgccgtgtgaagtgccaggccctgaacaaatgggagccggagcta
ccaagctgctccagggtatgtcagccacctccagatgtcctgcatgctgagcgtacccaa
agggacaaggacaacttttcacccgggcaggaagtgttctacagctgtgagcccggctat
gacctcagaggggctgcgtctatgcgctgcacaccccagggagactggagccctgcagcc
cccacatgtgaagtgaaatcctgtgatgacttcatgggccaacttcttaatggccgtgtg
ctatttccagtaaatctccagcttggagcaaaagtggattttgtttgtgatgaaggattt
caattaaaaggcagctctgctagttattgtgtcttggctggaatggaaagcctttggaat
agcagtgttccagtgtgtgaacaaatcttttgtccaagtcctccagttattcctaatggg
agacacacaggaaaacctctggaagtctttccctttggaaaagcagtaaattacacatgc
gacccccacccagacagagggacgagcttcgacctcattggagagagcaccatccgctgc
acaagtgaccctcaagggaatggggtttggagcagccctgcccctcgctgtggaattctg
ggtcactgtcaagccccagatcattttctgtttgccaagttgaaaacccaaaccaatgca
tctgactttcccattgggacatctttaaagtacgaatgccgtcctgagtactacgggagg
ccattctctatcacatgtctagataacctggtctggtcaagtcccaaagatgtctgtaaa
cgtaaatcatgtaaaactcctccagatccagtgaatggcatggtgcatgtgatcacagac
atccaggttggatccagaatcaactattcttgtactacagggcaccgactcattggtcac
tcatctgctgaatgtatcctctcaggcaatactgcccattggagcacgaagccgccaatt
tgtcaacgaattccttgtgggctacccccaaccatcgccaatggagatttcattagcacc
aacagagagaattttcactatggatcagtggtgacctaccgctgcaatcttggaagcaga
gggagaaaggtgtttgagcttgtgggtgagccctccatatactgcaccagcaatgacgat
caagtgggcatctggagcggccccgcccctcagtgcattatacctaacaaatgcacgcct
ccaaatgtggaaaatggaatattggtatctgacaacagaagcttattttccttaaatgaa
gttgtggagtttaggtgtcagcctggctttgtcatgaaaggaccccgccgtgtgaagtgc
caggccctgaacaaatgggagccagagttaccaagctgctccagggtgtgtcagccgcct
ccagaaatcctgcatggtgagcataccccaagccatcaggacaacttttcacctgggcag
gaagtgttctacagctgtgagcctggctatgacctcagaggggctgcgtctctgcactgc
acaccccagggagactggagccctgaagccccgagatgtgcagtgaaatcctgtgatgac
ttcttgggtcaactccctcatggccgtgtgctatttccacttaatctccagcttggggca
aaggtgtcctttgtctgtgatgaagggtttcgcttaaagggcagttccgttagtcattgt
gtcttggttggaatgagaagcctttggaataacagtgttcctgtgtgtgaacatatcttt
tgtccaaatcctccagctatccttaatgggagacacacaggaactccctctggagatatt
ccctatggaaaagaaatatcttacacatgtgacccccacccagacagagggatgaccttc
aacctcattggggagagcaccatccgctgcacaagtgaccctcatgggaatggggtttgg
agcagccctgcccctcgctgtgaactttctgttcgtgctggtcactgtaaaaccccagag
cagtttccatttgccagtcctacgatcccaattaatgactttgagtttccagtcgggaca
tctttgaattatgaatgccgtcctgggtattttgggaaaatgttctctatctcctgccta
gaaaacttggtctggtcaagtgttgaagacaactgtagacgaaaatcatgtggacctcca
ccagaacccttcaatggaatggtgcatataaacacagatacacagtttggatcaacagtt
aattattcttgtaatgaagggtttcgactcattggttccccatctactacttgtctcgtc
tcaggcaataatgtcacatgggataagaaggcacctatttgtgagatcatatcttgtgag
ccacctccaaccatatccaatggagacttctacagcaacaatagaacatcttttcacaat
ggaacggtggtaacttaccagtgccacactggaccagatggagaacagctgtttgagctt
gtgggagaacggtcaatatattgcaccagcaaagatgatcaagttggtgtttggagcagc
cctccccctcggtgtatttctactaataaatgcacagctccagaagttgaaaatgcaatt
agagtaccaggaaacaggagtttctttaccctcactgagatcatcagatttagatgtcag
cccgggtttgtcatggtagggtcccacactgtgcagtgccagaccaatggcagatggggg
cccaagctgccacactgctccagggtgtgtcagccgcctccagaaatcctgcatggtgag
cataccctaagccatcaggacaacttttcacctgggcaggaagtgttctacagctgtgag
cccagctatgacctcagaggggctgcgtctctgcactgcacgccccagggagactggagc
cctgaagcccctagatgtacagtgaaatcctgtgatgacttcctgggccaactccctcat
ggccgtgtgctacttccacttaatctccagcttggggcaaaggtgtcctttgtttgcgat
gaagggttccgattaaaaggcaggtctgctagtcattgtgtcttggctggaatgaaagcc
ctttggaatagcagtgttccagtgtgtgaacaaatcttttgtccaaatcctccagctatc
cttaatgggagacacacaggaactccctttggagatattccctatggaaaagaaatatct
tacgcatgcgacacccacccagacagagggatgaccttcaacctcattggggagagctcc
atccgctgcacaagtgaccctcaagggaatggggtttggagcagccctgcccctcgctgt
gaactttctgttcctgctgcctgcccacatccacccaagatccaaaacgggcattacatt
ggaggacacgtatctctatatcttcctgggatgacaatcagctacatttgtgaccccggc
tacctgttagtgggaaagggcttcattttctgtacagaccagggaatctggagccaattg
gatcattattgcaaagaagtaaattgtagcttcccactgtttatgaatggaatctcgaag
gagttagaaatgaaaaaagtatatcactatggagattatgtgactttgaagtgtgaagat
gggtatactctggaaggcagtccctggagccagtgccaggcggatgacagatgggaccct
cctctggccaaatgtacctctcgtacacatgatgctctcatagttggcactttatctggt
acgatcttctttattttactcatcattttcctctcttggataattctaaagcacagaaaa
ggcaataatgcacatgaaaaccctaaagaagtggctatccatttacattctcaaggaggc
agcagcgttcatccccgaactctgcaaacaaatgaagaaaatagcagggtccttccttga

DBGET integrated database retrieval system