KEGG   Homo sapiens (human): 137964Help
Entry
137964            CDS       T01001                                 

Gene name
AGPAT6, 1-AGPAT_6, LPAAT-zeta, LPAATZ, TSARG7
Definition
1-acylglycerol-3-phosphate O-acyltransferase 6 (EC:2.3.1.15)
Orthology
K13506  
glycerol-3-phosphate O-acyltransferase 3/4 [EC:2.3.1.15]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Module
Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    137964 (AGPAT6)
   00564 Glycerophospholipid metabolism
    137964 (AGPAT6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.15  glycerol-3-phosphate 1-O-acyltransferase
     137964 (AGPAT6)
Lipid biosynthesis proteins [BR:hsa01004]
 Phospholipid acyltransferase
  GPAT
   137964 (AGPAT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.21
AA seq 456 aa AA seqDB search
MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFGVSFGIRKLYMKSLLKIFAWATLR
MERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCR
KGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRI
ALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALTAIITYHDRENRPRN
GGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHL
VAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAF
WNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLL
WDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgttgctgccttttgatagcctgattgtcaaccttctgggcatctccctgact
gtcctcttcaccctccttctcgttttcatcatagtgccagccatttttggagtctccttt
ggtatccgcaaactctacatgaaaagtctgttaaaaatctttgcgtgggctaccttgaga
atggagcgaggagccaaggagaagaaccaccagctttacaagccctacaccaacggaatc
attgcaaaggatcccacttcactagaagaagagatcaaagagattcgtcgaagtggtagt
agtaaggctctggacaacactccagagttcgagctctctgacattttctacttttgccgg
aaaggaatggagaccattatggatgatgaggtgacaaagagattctcagcagaagaactg
gagtcctggaacctgctgagcagaaccaattataacttccagtacatcagccttcggctc
acggtcctgtgggggttaggagtgctgattcggtactgctttctgctgccgctcaggata
gcactggctttcacagggattagccttctggtggtgggcacaactgtggtgggatacttg
ccaaatgggaggtttaaggagttcatgagtaaacatgttcacttaatgtgttaccggatc
tgcgtgcgagcgctgacagccatcatcacctaccatgacagggaaaacagaccaagaaat
ggtggcatctgtgtggccaatcatacctcaccgatcgatgtgatcatcttggccagcgat
ggctattatgccatggtgggtcaagtgcacgggggactcatgggtgtgattcagagagcc
atggtgaaggcctgcccacacgtctggtttgagcgctcggaagtgaaggatcgccacctg
gtggctaagagactgactgaacatgtgcaagataaaagcaagctgcctatcctcatcttc
ccagaaggaacctgcatcaataatacatcggtgatgatgttcaaaaagggaagttttgaa
attggagccacagtttaccctgttgctatcaagtatgaccctcaatttggcgatgccttc
tggaacagcagcaaatacgggatggtgacgtacctgctgcgaatgatgaccagctgggcc
attgtctgcagcgtgtggtacctgcctcccatgactagagaggcagatgaagatgctgtc
cagtttgcgaatagggtgaaatctgccattgccaggcagggaggacttgtggacctgctg
tgggatgggggcctgaagagggagaaggtgaaggacacgttcaaggaggagcagcagaag
ctgtacagcaagatgatcgtggggaaccacaaggacaggagccgctcctga

DBGET integrated database retrieval system