KEGG   Homo sapiens (human): 137964Help
Entry
137964            CDS       T01001                                 

Gene name
AGPAT6, 1-AGPAT_6, LPAAT-zeta, LPAATZ, TSARG7
Definition
1-acylglycerol-3-phosphate O-acyltransferase 6 (EC:2.3.1.15)
Orthology
K13506  
glycerol-3-phosphate O-acyltransferase 3/4 [EC:2.3.1.15]
Organism
hsa  Homo sapiens (human)
Pathway
Glycerolipid metabolism
Glycerophospholipid metabolism
Metabolic pathways
Module
Triacylglycerol biosynthesis
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:hsa00561]
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:hsa00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p11.21
AA seq 456 aa AA seqDB search
MFLLLPFDSLIVNLLGISLTVLFTLLLVFIIVPAIFGVSFGIRKLYMKSLLKIFAWATLR
MERGAKEKNHQLYKPYTNGIIAKDPTSLEEEIKEIRRSGSSKALDNTPEFELSDIFYFCR
KGMETIMDDEVTKRFSAEELESWNLLSRTNYNFQYISLRLTVLWGLGVLIRYCFLLPLRI
ALAFTGISLLVVGTTVVGYLPNGRFKEFMSKHVHLMCYRICVRALTAIITYHDRENRPRN
GGICVANHTSPIDVIILASDGYYAMVGQVHGGLMGVIQRAMVKACPHVWFERSEVKDRHL
VAKRLTEHVQDKSKLPILIFPEGTCINNTSVMMFKKGSFEIGATVYPVAIKYDPQFGDAF
WNSSKYGMVTYLLRMMTSWAIVCSVWYLPPMTREADEDAVQFANRVKSAIARQGGLVDLL
WDGGLKREKVKDTFKEEQQKLYSKMIVGNHKDRSRS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgttgctgccttttgatagcctgattgtcaaccttctgggcatctccctgact
gtcctcttcaccctccttctcgttttcatcatagtgccagccatttttggagtctccttt
ggtatccgcaaactctacatgaaaagtctgttaaaaatctttgcgtgggctaccttgaga
atggagcgaggagccaaggagaagaaccaccagctttacaagccctacaccaacggaatc
attgcaaaggatcccacttcactagaagaagagatcaaagagattcgtcgaagtggtagt
agtaaggctctggacaacactccagagttcgagctctctgacattttctacttttgccgg
aaaggaatggagaccattatggatgatgaggtgacaaagagattctcagcagaagaactg
gagtcctggaacctgctgagcagaaccaattataacttccagtacatcagccttcggctc
acggtcctgtgggggttaggagtgctgattcggtactgctttctgctgccgctcaggata
gcactggctttcacagggattagccttctggtggtgggcacaactgtggtgggatacttg
ccaaatgggaggtttaaggagttcatgagtaaacatgttcacttaatgtgttaccggatc
tgcgtgcgagcgctgacagccatcatcacctaccatgacagggaaaacagaccaagaaat
ggtggcatctgtgtggccaatcatacctcaccgatcgatgtgatcatcttggccagcgat
ggctattatgccatggtgggtcaagtgcacgggggactcatgggtgtgattcagagagcc
atggtgaaggcctgcccacacgtctggtttgagcgctcggaagtgaaggatcgccacctg
gtggctaagagactgactgaacatgtgcaagataaaagcaagctgcctatcctcatcttc
ccagaaggaacctgcatcaataatacatcggtgatgatgttcaaaaagggaagttttgaa
attggagccacagtttaccctgttgctatcaagtatgaccctcaatttggcgatgccttc
tggaacagcagcaaatacgggatggtgacgtacctgctgcgaatgatgaccagctgggcc
attgtctgcagcgtgtggtacctgcctcccatgactagagaggcagatgaagatgctgtc
cagtttgcgaatagggtgaaatctgccattgccaggcagggaggacttgtggacctgctg
tgggatgggggcctgaagagggagaaggtgaaggacacgttcaaggaggagcagcagaag
ctgtacagcaagatgatcgtggggaaccacaaggacaggagccgctcctga

DBGET integrated database retrieval system