KEGG   Homo sapiens (human): 137970Help
Entry
137970            CDS       T01001                                 

Gene name
UNC5D, PRO34692, Unc5h4
Definition
(RefSeq) unc-5 netrin receptor D
  KO
K07521  
netrin receptor unc-5
Organism
hsa  Homo sapiens (human)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Development
   04360 Axon guidance
    137970 (UNC5D)
Cell adhesion molecules and their ligands [BR:hsa04516]
 1. Immunoglobulin Superfamily
  Others
   ROBO4; roundabout, axon guidance receptor, homolog 4 (Drosophila) [KO:K06784]
    137970 (UNC5D)
 7. Others
  FLRT; leucine-rich repeat transmembrane protein FLRT [KO:K16362]
   137970 (UNC5D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q6UXZ4(Tbio)
UniProt: 
Position
8p12
AA seq 953 aa AA seqDB search
MGRAAATAGGGGGARRWLPWLGLCFWAAGTAAARGTDNGEALPESIPSAPGTLPHFIEEP
DDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTR
QQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHC
RPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKR
RSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKIT
CTSLCPVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCI
LDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSAL
TGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSD
IKVKVQSSFMVSLGVSERAEYHGKNHSRTFPHGNNHSFSTMHPRNKMPYIQNLSSLPTRT
ELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLS
PEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCL
LDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAF
QEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWC
SNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDS
TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAV
ILNLWEARHQHDGDLDSLACALEEIGRTHTKLSNISESQLDEADFNYSRQNGL
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggggagagcggcggccaccgcaggcggcggcggaggggcgcgccgctggctcccgtgg
ctggggctgtgcttctgggcggcagggaccgcggctgcccgaggaactgacaatggcgaa
gcccttcccgaatccatcccatcagctcctgggacactgcctcatttcatagaggagcca
gatgatgcttatattatcaagagcaaccctattgcactcaggtgcaaagcgaggccagcc
atgcagatattcttcaaatgcaacggcgagtgggtccatcagaacgagcacgtctctgaa
gagactctggacgagagctcaggtttgaaggtccgcgaagtgttcatcaatgttactagg
caacaggtggaggacttccatgggcccgaggactattggtgccagtgtgtggcgtggagc
cacctgggtacctccaagagcaggaaggcctctgtgcgcatagcctatttacggaaaaac
tttgaacaagacccacaaggaagggaagttcccattgaaggcatgattgtactgcactgc
cgcccaccagagggagtccctgctgccgaggtggaatggctgaaaaatgaagagcccatt
gactctgaacaagacgagaacattgacaccagggctgaccataacctgatcatcaggcag
gcacggctctcggactcaggaaattacacctgcatggcagccaacatcgtggctaagagg
agaagcctgtcggccactgttgtggtctacgtgaatggaggctggtcttcctggacagag
tggtcagcctgcaatgttcgctgtggtagaggatggcagaaacgttcccggacctgcacc
aacccagctcctctcaatggtggggccttttgtgagggaatgtcagtgcagaaaataacc
tgcacttctctttgtcctgtggatgggagctgggaagtgtggagcgaatggtccgtctgc
agtccagagtgtgaacatttgcggatccgggagtgcacagcaccacccccgagaaatggg
ggcaaattctgtgaaggtctaagccaggaatctgaaaactgcacagatggtctttgcatc
ctagataaaaaacctcttcatgaaataaaaccccaaagcattgagaatgccagcgacatt
gctttgtactcgggcttgggtgctgccgtcgtggccgttgcagtcctggtcattggtgtc
accctttacagacggagccagagtgactatggcgtggacgtcattgactcttctgcattg
acaggtggcttccagaccttcaacttcaaaacagtccgtcaaggtaactccctgctcctg
aattctgccatgcagccagatctgacagtgagccggacatacagcggacccatctgtctg
caggaccctctggacaaggagctcatgacagagtcctcactctttaaccctttgtcggac
atcaaagtgaaagtccagagctcgttcatggtttccctgggagtgtctgagagagctgag
taccacggcaagaatcattccaggacttttccccatggaaacaaccacagctttagtaca
atgcatcccagaaataaaatgccctacatccaaaatctgtcatcactccccacaaggaca
gaactgaggacaactggtgtctttggccatttaggggggcgcttagtaatgccaaataca
ggggtgagcttactcataccacacggtgccatcccagaggagaattcttgggagatttat
atgtccatcaaccaaggtgaacccagcctccagtcagatggctctgaggtgctcctgagt
cctgaagtcacctgtggtcctccagacatgatcgtcaccactccctttgcattgaccatc
ccgcactgtgcagatgtcagttctgagcattggaatatccatttaaagaagaggacacag
cagggcaaatgggaggaagtgatgtcagtggaagatgaatctacatcctgttactgcctt
ttggacccctttgcgtgtcatgtgctcctggacagctttgggacctatgcgctcactgga
gagccaatcacagactgtgccgtgaagcaactgaaggtggcggtttttggctgcatgtcc
tgtaactccctggattacaacttgagagtttactgtgtggacaataccccttgtgcattt
caggaagtggtttcagatgaaaggcatcaaggtggacagctcctggaagaaccaaaattg
ctgcatttcaaagggaatacctttagtcttcagatttctgtccttgatattcccccattc
ctctggagaattaaaccattcactgcctgccaggaagtcccgttctcccgcgtgtggtgc
agtaaccggcagcccctgcactgtgccttctccctggagcgttatacgcccactaccacc
cagctgtcctgcaaaatctgcattcggcagctcaaaggccatgaacagatcctccaagtg
cagacatcaatcctagagagtgaacgagaaaccatcactttcttcgcacaagaggacagc
actttccctgcacagactggccccaaagccttcaaaattccctactccatcagacagcgg
atttgtgctacatttgatacccccaatgccaaaggcaaggactggcagatgttagcacag
aaaaacagcatcaacaggaatttatcttatttcgctacacaaagtagcccatctgctgtc
attttgaacctgtgggaagctcgtcatcagcatgatggtgatcttgactccctggcctgt
gcccttgaagagattgggaggacacacacgaaactctcaaacatttcagaatcccagctt
gatgaagccgacttcaactacagcaggcaaaatggactctag

DBGET integrated database retrieval system