KEGG   Homo sapiens (human): 1384Help
Entry
1384              CDS       T01001                                 

Gene name
CRAT, CAT1
Definition
carnitine O-acetyltransferase (EC:2.3.1.7)
Orthology
K00624  
carnitine O-acetyltransferase [EC:2.3.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Class
Cellular Processes; Transport and catabolism; Peroxisome [PATH:hsa04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9q34.1
AA seq 626 aa AA seqDB search
MLAFAARTVVKPLGFLKPFSLMKASSRFKAHQDALPRLPVPPLQQSLDHYLKALQPIVSE
EEWAHTKQLVDEFQASGGVGERLQKGLERRARKTENWLSEWWLKTAYLQYRQPVVIYSSP
GVMLPKQDFVDLQGQLRFAAKLIEGVLDFKVMIDNETLPVEYLGGKPLCMNQYYQILSSC
RVPGPKQDTVSNFSKTKKPPTHITVVHNYQFFELDVYHSDGTPLTADQIFVQLEKIWNSS
LQTNKEPVGILTSNHRNSWAKAYNTLIKDKVNRDSVRSIQKSIFTVCLDATMPRVSEDVY
RSHVAGQMLHGGGSRLNSGNRWFDKTLQFIVAEDGSCGLVYEHAAAEGPPIVTLLDYVIE
YTKKPELVRSPMVPLPMPKKLRFNITPEIKSDIEKAKQNLSIMIQDLDITVMVFHHFGKD
FPKSEKLSPDAFIQMALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASMDSLTFVK
AMDDSSVTEHQKVELLRKAVQAHRGYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMD
TSYAIAMHFHLSTSQVPAKTDCVMFFGPVVPDGYGVCYNPMEAHINFSLSAYNSCAETNA
ARLAHYLEKALLDMRALLQSHPRAKL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgttagccttcgctgccaggaccgtggtgaagcctctgggcttcctgaagcccttctcc
ttgatgaaggcttccagccgcttcaaggcacaccaggatgcactgccacggctgcccgtg
ccccctctccagcagtccctggaccactacctgaaggcgctgcagcccatcgtgagtgag
gaggagtgggcccacaccaagcagctggtggatgagtttcaggcctcaggaggtgtaggg
gagcgcctgcagaaggggctggagcgtcgggccaggaagacggagaactggctgtctgag
tggtggctcaagaccgcctacctccagtaccgccagcctgtggtcatctactcgagccca
ggcgtgatgctacccaagcaggacttcgtggacctgcagggtcagctccgatttgctgcc
aaactcattgagggtgtgttggatttcaaggtcatgattgacaacgagaccctgcccgtg
gagtacctgggggggaagccactgtgcatgaaccagtactatcagatcttgtcctcctgc
cgagtgccgggccccaagcaggacacagtcagcaacttcagcaagaccaagaagcctccc
acgcacatcaccgtggtacacaactaccagttttttgagctggatgtgtaccacagtgac
gggacacccctcactgcggatcagatctttgtgcagctggagaagatctggaactcatcc
ctacagaccaacaaggagcctgtgggcatcctcacctccaaccaccgcaactcctgggcc
aaggcatacaacaccctcatcaaagacaaggtgaaccgggattccgtgcgctccatccag
aagagcatcttcaccgtgtgcctagatgcaaccatgcccagggtctcagaagacgtgtac
cgcagccacgtggcaggccagatgctgcatgggggcggcagcaggctcaacagcggcaac
cgctggttcgacaagacgctgcagttcatcgtggcagaagatggctcctgtgggcttgtg
tacgagcatgctgcagcggaggggccccctattgtcacccttctggactatgtcatcgag
tacacgaagaaacccgagcttgtgcggtctcccatggtgcccctgcccatgcccaagaag
ctgcggttcaacatcacccccgagatcaagagcgacatcgagaaggccaagcagaacctc
agcatcatgatccaggacctggatatcaccgtgatggtgttccaccattttggaaaagac
ttccccaagtcggagaagctaagcccagatgccttcatccagatggctttgcagctggcc
tactacaggatctacggacaggcatgtgccacctatgaaagtgcctccctgcgcatgttt
cacctgggccgcaccgacaccatccgctcggcttccatggactcactcacctttgtcaag
gccatggatgactccagcgtcacggagcaccagaaggtggagctgctgcggaaggccgtg
caggcccaccgaggctacaccgaccgggccatccgcggggaggcctttgatcgacacctg
ctgggcctgaagctgcaggccatcgaggacctggtgagcatgcccgacatcttcatggac
acctcctacgccatcgccatgcacttccacctctccaccagccaggtccctgccaagaca
gactgtgtcatgttcttcgggcccgtggtccccgacggctacggtgtctgctataacccc
atggaggcccacatcaacttctccctgtcggcctacaacagctgcgcggagaccaacgcc
gcccgcctggcgcattacctggagaaggcgctcctggacatgcgtgccctgctgcagagc
cacccccgggccaagctctga

DBGET integrated database retrieval system