KEGG   Homo sapiens (human): 138716Help
Entry
138716            CDS       T01001                                 

Gene name
RPP25L, C9orf23, bA296L22.5
Definition
(RefSeq) ribonuclease P/MRP subunit p25 like
  KO
K14525  
ribonucleases P/MRP protein subunit RPP25 [EC:3.1.26.5]
Organism
hsa  Homo sapiens (human)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    138716 (RPP25L)
   03008 Ribosome biogenesis in eukaryotes
    138716 (RPP25L)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     138716 (RPP25L)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     138716 (RPP25L)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    138716 (RPP25L)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    138716 (RPP25L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q8N5L8(Tdark)
UniProt: 
Position
9p13.3
AA seq 163 aa AA seqDB search
MEHYRKAGSVELPAPSPMPQLPPDTLEMRVRDGSKIRNLLGLALGRLEGGSARHVVFSGS
GRAAGKAVSCAEIVKRRVPGLHQLTKLRFLQTEDSWVPASPDTGLDPLTVRRHVPAVWVL
LSRDPLDPNECGYQPPGAPPGLGSMPSSSCGPRSRRRARDTRS
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggagcactaccggaaagctggctctgtagagctcccagcgccttccccaatgccccag
ctacctcctgatacccttgagatgcgggtccgagatggcagcaaaattcgcaacctgctg
gggttggctctgggtcggttggagggcggcagtgctcggcatgtagtgttctcaggttct
ggcagggctgcaggaaaggctgtcagctgcgctgagattgtcaagcggcgggtcccaggc
ctgcaccagctcaccaagctacgtttccttcagactgaggacagctgggtcccagcctca
cctgacacagggctagaccccctcacagtgcgccgccatgtgcctgcagtgtgggtgctg
ctcagccgggaccccctggaccccaatgagtgtggttaccaacccccaggagcaccccct
ggcctgggttccatgcccagctccagctgtggccctcgttcccgaagaagggctcgagac
acccgatcgtga

DBGET integrated database retrieval system