KEGG   Homo sapiens (human): 1388Help
Entry
1388              CDS       T01001                                 

Gene name
ATF6B, CREB-RP, CREBL1, G13
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing's syndrome
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05203  Viral carcinogenesis
Network
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1388 (ATF6B)
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    1388 (ATF6B)
   04022 cGMP - PKG signaling pathway
    1388 (ATF6B)
   04151 PI3K-Akt signaling pathway
    1388 (ATF6B)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    1388 (ATF6B)
   04915 Estrogen signaling pathway
    1388 (ATF6B)
   04926 Relaxin signaling pathway
    1388 (ATF6B)
   04918 Thyroid hormone synthesis
    1388 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    1388 (ATF6B)
   04925 Aldosterone synthesis and secretion
    1388 (ATF6B)
   04927 Cortisol synthesis and secretion
    1388 (ATF6B)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1388 (ATF6B)
  Nervous system
   04728 Dopaminergic synapse
    1388 (ATF6B)
  Aging
   04211 Longevity regulating pathway - mammal
    1388 (ATF6B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1388 (ATF6B)
  Substance dependence
   05030 Cocaine addiction
    1388 (ATF6B)
   05031 Amphetamine addiction
    1388 (ATF6B)
   05034 Alcoholism
    1388 (ATF6B)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    1388 (ATF6B)
  Infectious diseases
   05161 Hepatitis B
    1388 (ATF6B)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    1388 (ATF6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB YabB GIT_CC
Motif
Other DBs
NCBI-GeneID: 1388
NCBI-ProteinID: NP_004372
OMIM: 600984
HGNC: 2349
Ensembl: ENSG00000213676
Vega: OTTHUMG00000031296
Pharos: Q99941(Tbio)
UniProt: Q99941 Q6AZW6
Position
6p21.32
AA seq 703 aa AA seqDB search
MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDG
SSLDVGMDVSPSEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGE
VLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCSSVNSEASL
LSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTR
KPPLQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
SAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAF
PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKS
QPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgatgctgctcagcgagattgctgacccgacgcgtttcttcaccgacaac
ctgcttagcccggaggactggggtctgcagaacagcaccttgtattctggcctagatgaa
gtggccgaggagcagacgcagctcttccgttgcccggagcaggatgtcccgtttgacggc
agctccctggacgtggggatggatgtcagcccctctgagcccccatgggaactcctgccg
atcttcccagatcttcaggtgaagtctgagccatcttccccctgctcttcctcctccctc
agctccgagtcatcgcgtctctccacagagccatccagcgaggctcttggggtaggggag
gtgctccatgtgaagacagagtccttggcacccccactgtgtctcctgggagatgaccca
acatcctcatttgaaaccgtccagatcaacgttatccccacctctgatgattcctcagat
gtccagaccaagatagaacctgtctctccatgttcttccgtcaactctgaggcctccctg
ctctcagccgactcctccagccaggcttttataggagaggaggtcctggaagtgaagaca
gagtccctgtccccttcaggatgcctcctgtgggatgtcccagccccctcacttggagct
gtccagatcagcatgggcccatcccttgatggctcctcaggcaaagccctgcccacccgg
aagccgccactgcagcccaaacctgtagtgctaaccactgtcccaatgccatccagagct
gtgcctcccagcaccacagtccttctgcagtccctcgtccagccacccccagtgtcccca
gttgtcctcatccagggtgctattcgagtccagcctgaagggccggctccctctctacca
cggcctgagaggaagagcatcgttcccgctcctatgcctggaaactcctgcccgcctgaa
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcagcctgc
cagtcccggagaaagaagaaagagtatctgcagggactggaggctcggctgcaagcagta
ctggctgacaaccagcagctccgccgagagaatgctgccctccggcggcggctggaggcc
ctgctggctgaaaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatc
atggtcttccttctcttcattgccttcaactttggacctgtcagcatcagtgagcctcct
tcagctcccatctctcctcggatgaacaagggggagcctcaaccccggagacacttgctg
gggttctcagagcaagagccagttcagggagttgaacctctccaggggtcctcccagggc
cctaaggagccccagcccagccccacagaccagcccagtttcagcaacctgacagccttc
cctgggggcgccaaggagctactactaagagacctagaccagctcttcctctcctctgat
tgccggcacttcaaccgcactgagtccctgaggcttgctgacgagttgagtggctgggtc
cagcgccaccagagaggccggaggaagatccctcagagggcccaggagagacagaagtct
cagccacggaagaagtcacctccagttaaggcagtccccatccaaccccctggaccccca
gaaagggattctgtgggccagctgcaactatatcgccacccagaccgttcgcagccagca
ttcttggatgcaattgaccgacgggaagacacattttatgttgtctctttccgaagggac
cacctgctgctcccagccatcagccacaacaagacctcccggcccaagatgtccctggtg
atgcctgccatggcccccaatgagaccctgtcaggccgtggggccccgggggactatgag
gagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctcc
acagtgcccccctcgctccgaaaacagccatccccaaccccaggcaatgccacaggtggc
cccttgccagtctctgcagccagccaggcccaccaggcctcccaccagcccctctacctc
aatcatccctga

DBGET integrated database retrieval system