KEGG   Homo sapiens (human): 1388Help
Entry
1388              CDS       T01001                                 

Gene name
ATF6B, CREB-RP, CREBL1, G13
Definition
activating transcription factor 6 beta
Orthology
K09049  
cyclic AMP-dependent transcription factor ATF-6 beta
Organism
hsa  Homo sapiens (human)
Pathway
cGMP-PKG signaling pathway
Protein processing in endoplasmic reticulum
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
TNF signaling pathway
Dopaminergic synapse
Insulin secretion
Estrogen signaling pathway
Thyroid hormone synthesis
Cocaine addiction
Amphetamine addiction
Alcoholism
Hepatitis B
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1388 (ATF6B)
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    1388 (ATF6B)
   04022 cGMP - PKG signaling pathway
    1388 (ATF6B)
   04151 PI3K-Akt signaling pathway
    1388 (ATF6B)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    1388 (ATF6B)
   04915 Estrogen signaling pathway
    1388 (ATF6B)
   04918 Thyroid hormone synthesis
    1388 (ATF6B)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1388 (ATF6B)
  Nervous system
   04728 Dopaminergic synapse
    1388 (ATF6B)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    1388 (ATF6B)
  Substance dependence
   05030 Cocaine addiction
    1388 (ATF6B)
   05031 Amphetamine addiction
    1388 (ATF6B)
   05034 Alcoholism
    1388 (ATF6B)
  Infectious diseases
   05161 Hepatitis B
    1388 (ATF6B)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    1388 (ATF6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p21.3
AA seq 700 aa AA seqDB search
MAELMLLSEIADPTRFFTDNLLSPEDWDSTLYSGLDEVAEEQTQLFRCPEQDVPFDGSSL
DVGMDVSPSEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGEVLH
VKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCSSVNSEASLLSA
DSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTRKPP
LQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLPRPE
RKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLAD
NQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPSAP
ISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAFPGG
AKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQPR
KKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRDHLL
LPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTSTVP
PSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgatgctgctcagcgagattgctgacccgacgcgtttcttcaccgacaac
ctgcttagcccggaggactgggacagcaccttgtattctggcctagatgaagtggccgag
gagcagacgcagctcttccgttgcccggagcaggatgtcccgtttgacggcagctccctg
gacgtggggatggatgtcagcccctctgagcccccatgggaactcctgccgatcttccca
gatcttcaggtgaagtctgagccatcttccccctgctcttcctcctccctcagctccgag
tcatcgcgtctctccacagagccatccagcgaggctcttggggtaggggaggtgctccat
gtgaagacagagtccttggcacccccactgtgtctcctgggagatgacccaacatcctca
tttgaaaccgtccagatcaacgttatccccacctctgatgattcctcagatgtccagacc
aagatagaacctgtctctccatgttcttccgtcaactctgaggcctccctgctctcagcc
gactcctccagccaggcttttataggagaggaggtcctggaagtgaagacagagtccctg
tccccttcaggatgcctcctgtgggatgtcccagccccctcacttggagctgtccagatc
agcatgggcccatcccttgatggctcctcaggcaaagccctgcccacccggaagccgcca
ctgcagcccaaacctgtagtgctaaccactgtcccaatgccatccagagctgtgcctccc
agcaccacagtccttctgcagtccctcgtccagccacccccagtgtccccagttgtcctc
atccagggtgctattcgagtccagcctgaagggccggctccctctctaccacggcctgag
aggaagagcatcgttcccgctcctatgcctggaaactcctgcccgcctgaagtggatgca
aagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcagcctgccagtcccgg
agaaagaagaaagagtatctgcagggactggaggctcggctgcaagcagtactggctgac
aaccagcagctccgccgagagaatgctgccctccggcggcggctggaggccctgctggct
gaaaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatcatggtcttc
cttctcttcattgccttcaactttggacctgtcagcatcagtgagcctccttcagctccc
atctctcctcggatgaacaagggggagcctcaaccccggagacacttgctggggttctca
gagcaagagccagttcagggagttgaacctctccaggggtcctcccagggccctaaggag
ccccagcccagccccacagaccagcccagtttcagcaacctgacagccttccctgggggc
gccaaggagctactactaagagacctagaccagctcttcctctcctctgattgccggcac
ttcaaccgcactgagtccctgaggcttgctgacgagttgagtggctgggtccagcgccac
cagagaggccggaggaagatccctcagagggcccaggagagacagaagtctcagccacgg
aagaagtcacctccagttaaggcagtccccatccaaccccctggacccccagaaagggat
tctgtgggccagctgcaactatatcgccacccagaccgttcgcagccagcattcttggat
gcaattgaccgacgggaagacacattttatgttgtctctttccgaagggaccacctgctg
ctcccagccatcagccacaacaagacctcccggcccaagatgtccctggtgatgcctgcc
atggcccccaatgagaccctgtcaggccgtggggccccgggggactatgaggagatgatg
cagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctccacagtgccc
ccctcgctccgaaaacagccatccccaaccccaggcaatgccacaggtggccccttgcca
gtctctgcagccagccaggcccaccaggcctcccaccagcccctctacctcaatcatccc
tga

DBGET integrated database retrieval system