KEGG   Homo sapiens (human): 138803Help
Entry
138803            CDS       T01001                                 

Gene name
OR13C3, OR37G, OR9-8
Definition
(RefSeq) olfactory receptor family 13 subfamily C member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    138803 (OR13C3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    138803 (OR13C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 Peptidase_A2B
Motif
Other DBs
NCBI-GeneID: 138803
NCBI-ProteinID: NP_001001961
HGNC: 14704
Ensembl: ENSG00000204246
Vega: OTTHUMG00000020406
Pharos: Q8NGS6(Tdark)
UniProt: Q8NGS6 A0A126GVY9
Position
9q31.1
AA seq 347 aa AA seqDB search
MIVQLICTVCFLAVNTFHVRSSFDFLKADDMGEINQTLVSEFLLLGLSGYPKIEIVYFAL
ILVMYLVILIGNGVLIIASIFDSHFHTPMYFFLGNLSFLDICYTSSSVPSTLVSLISKKR
NISFSGCAVQMFFGFAMGSTECLLLGMMAFDRYVAICNPLRYPIILSKVAYVLMASVSWL
SGGINSAVQTLLAMRLPFCGNNIINHFACEILAVLKLACADISLNIITMVISNMAFLVLP
LMVIFFSYMFILYTILQMNSATGRRKAFSTCSAHLTVVIIFYGTIFFMYAKPKSQDLIGE
EKLQALDKLISLFYGVVTPMLNPILYSLRNKDVKAAVKYLLNKKPIH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgattgttcagttaatttgtactgtttgtttcttggcagtaaatacatttcatgttaga
tcttcttttgatttcctgaaagcagatgacatgggtgagattaaccagacacttgtgtca
gaatttcttcttctgggtctttctggatacccaaagattgagattgtttactttgctctc
attctagttatgtacctagtgattctaattggcaatggtgttctaatcatagccagcatc
tttgattctcattttcacacaccaatgtacttcttcctgggcaacctctctttcctggat
atctgctatacatcctcctctgttccctcaacattggtgagcttaatctcaaagaaaaga
aacatttccttctctggatgtgcagtgcagatgttctttgggtttgcaatggggtcaaca
gaatgtctgcttcttggcatgatggcatttgatcgttatgtggccatctgcaacccactg
agataccccatcatcctgagcaaggtggcgtatgtattgatggcttctgtgtcctggctg
tccggtggaataaattcagctgtgcaaacattacttgccatgagactgcctttctgtggg
aataatattatcaatcatttcgcatgtgaaatattagctgtcctcaagctggcctgtgct
gatatatccctcaatattatcaccatggtgatatcaaatatggccttcctggttcttcca
ctgatggtcatttttttctcctatatgttcatcctctacaccatcttgcaaatgaattca
gccacaggaagacgcaaggcattttccacgtgctcagctcacctgactgtggtgatcata
ttttacggtaccatcttctttatgtatgcgaaaccgaagtctcaagacctgattggggaa
gaaaaattgcaagcattagacaagctcatttctctgttttatggggtagtgacacccatg
ctgaatcctatactctatagcttgagaaataaggatgtaaaagctgctgtaaaatatttg
ctgaacaaaaaaccaattcactaa

DBGET integrated database retrieval system