KEGG   Homo sapiens (human): 138803Help
Entry
138803            CDS       T01001                                 

Gene name
OR13C3, OR37G, OR9-8
Definition
olfactory receptor, family 13, subfamily C, member 3
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    138803 (OR13C3)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    138803 (OR13C3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q31.1
AA seq 347 aa AA seqDB search
MIVQLICTVCFLAVNTFHVRSSFDFLKADDMGEINQTLVSEFLLLGLSGYPKIEIVYFAL
ILVMYLVILIGNGVLIIASIFDSHFHTPMYFFLGNLSFLDICYTSSSVPSTLVSLISKKR
NISFSGCAVQMFFGFAMGSTECLLLGMMAFDRYVAICNPLRYPIILSKVAYVLMASVSWL
SGGINSAVQTLLAMRLPFCGNNIINHFACEILAVLKLACADISLNIITMVISNMAFLVLP
LMVIFFSYMFILYTILQMNSATGRRKAFSTCSAHLTVVIIFYGTIFFMYAKPKSQDLIGE
EKLQALDKLISLFYGVVTPMLNPILYSLRNKDVKAAVKYLLNKKPIH
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgattgttcagttaatttgtactgtttgtttcttggcagtaaatacatttcatgttaga
tcttcttttgatttcctgaaagcagatgacatgggtgagattaaccagacacttgtgtca
gaatttcttcttctgggtctttctggatacccaaagattgagattgtttactttgctctc
attctagttatgtacctagtgattctaattggcaatggtgttctaatcatagccagcatc
tttgattctcattttcacacaccaatgtacttcttcctgggcaacctctctttcctggat
atctgctatacatcctcctctgttccctcaacattggtgagcttaatctcaaagaaaaga
aacatttccttctctggatgtgcagtgcagatgttctttgggtttgcaatggggtcaaca
gaatgtctgcttcttggcatgatggcatttgatcgttatgtggccatctgcaacccactg
agataccccatcatcctgagcaaggtggcgtatgtattgatggcttctgtgtcctggctg
tccggtggaataaattcagctgtgcaaacattacttgccatgagactgcctttctgtggg
aataatattatcaatcatttcgcatgtgaaatattagctgtcctcaagctggcctgtgct
gatatatccctcaatattatcaccatggtgatatcaaatatggccttcctggttcttcca
ctgatggtcatttttttctcctatatgttcatcctctacaccatcttgcaaatgaattca
gccacaggaagacgcaaggcattttccacgtgctcagctcacctgactgtggtgatcata
ttttacggtaccatcttctttatgtatgcgaaaccgaagtctcaagacctgattggggaa
gaaaaattgcaagcattagacaagctcatttctctgttttatggggtagtgacacccatg
ctgaatcctatactctatagcttgagaaataaggatgtaaaagctgctgtaaaatatttg
ctgaacaaaaaaccaattcactaa

DBGET integrated database retrieval system