KEGG   Homo sapiens (human): 138804Help
Entry
138804            CDS       T01001                                 

Gene name
OR13C4, HSHTPCRX17, HTPCRX17, OR2K1, OR37F, OR9-7
Definition
olfactory receptor, family 13, subfamily C, member 4
Orthology
K04257  
olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
Olfactory transduction
Class
Organismal Systems; Sensory system; Olfactory transduction [PATH:hsa04740]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q31.1
AA seq 318 aa AA seqDB search
MDKINQTFVREFILLGLSGYPKLEIIFFALILVMYVVILIGNGVLIIASILDSRLHMPMY
FFLGNLSFLDICYTTSSIPSTLVSLISKKRNISFSGCAVQMFFGFAMGSTECFLLGMMAF
DRYVAICNPLRYPIIMNKVVYVLLTSVSWLSGGINSTVQTSLAMRWPFCGNNIINHFLCE
ILAVLKLACSDISVNIVTLAVSNIAFLVLPLLVIFFSYMFILYTILRTNSATGRHKAFST
CSAHLTVVIIFYGTIFFMYAKPKSQDLLGKDNLQATEGLVSMFYGVVTPMLNPIIYSLRN
KDVKAAIKYLLSRKAINQ
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggacaagataaaccagacatttgtgagagaattcattcttctgggactctctggttac
cccaaacttgagatcattttctttgctctgattctagttatgtacgtagtgattctaatt
ggcaatggtgttctgatcatagcaagcatcttggattctcgtcttcacatgcccatgtac
ttcttcctgggcaacctctctttcctggatatctgctatacaacctcctccattccctca
acactggtgagcttaatctcaaagaaaagaaacatttccttctctggatgtgcagtgcag
atgttctttgggtttgcaatggggtcaacagaatgtttcctccttggcatgatggcattt
gatcgttatgtggccatctgtaaccctctgagataccccatcatcatgaacaaggtggtg
tatgtactgctgacttctgtatcatggctttctggtggaatcaattcaactgtgcaaaca
tcacttgccatgcgatggcctttctgtgggaacaatattattaatcatttcttatgcgag
atcttagctgtcctaaaattagcttgttctgatatatctgtcaatattgttaccctagca
gtgtcaaatattgctttcctagttcttcctctgctcgtgatttttttctcctatatgttc
atcctctacaccatcttgcgaacgaactcggccacaggaagacacaaggcattttctaca
tgctcagctcacctgactgtggtgatcatattttatggtaccatcttctttatgtatgca
aaacctaagtcccaggacctccttgggaaagacaacttgcaagctacagaggggcttgtt
tccatgttttatggggttgtgacccccatgttaaaccccataatctatagcttgagaaat
aaagatgtaaaagctgctataaaatatttgctgagcaggaaagctattaaccagtaa

DBGET integrated database retrieval system