KEGG   Homo sapiens (human): 138883Help
Entry
138883            CDS       T01001                                 

Gene name
OR1N1, OR1-26, OR1N3, OR9-22
Definition
(RefSeq) olfactory receptor family 1 subfamily N member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    138883 (OR1N1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    138883 (OR1N1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 138883
NCBI-ProteinID: NP_036495
HGNC: 8221
Ensembl: ENSG00000171505
Vega: OTTHUMG00000020608
Pharos: Q8NGS0(Tdark)
UniProt: Q8NGS0 A0A126GW31
Position
9q33.2
AA seq 311 aa AA seqDB search
MENQSSISEFFLRGISAPPEQQQSLFGIFLCMYLVTLTGNLLIILAIGSDLHLHTPMYFF
LANLSFVDMGLTSSTVTKMLVNIQTRHHTISYTGCLTQMYFFLMFGDLDSFFLAAMAYDR
YVAICHPLCYSTVMRPQVCALMLALCWVLTNIVALTHTFLMARLSFCVTGEIAHFFCDIT
PVLKLSCSDTHINEMMVFVLGGTVLIVPFLCIVTSYIHIVPAILRVRTRGGVGKAFSTCS
SHLCVVCVFYGTLFSAYLCPPSIASEEKDIAAAAMYTIVTPMLNPFIYSLRNKDMKGALK
RLFSHRSIVSS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaccaatccagcatttctgaatttttcctccgaggaatatcagcgcctccagag
caacagcagtccctcttcggaattttcctgtgtatgtatcttgtcaccttgactgggaac
ctgctcatcatcctggccattggctctgacctgcacctccacacccccatgtactttttc
ttggccaacctgtcttttgttgacatgggtttaacgtcctccacagttaccaagatgctg
gtgaatatacagactcggcatcacaccatctcctatacgggttgcctcacgcaaatgtat
ttctttctgatgtttggtgatctagacagcttcttcctggctgccatggcgtatgaccgc
tatgtggccatttgccaccccctctgctactccacagtcatgaggccccaagtctgtgcc
ctaatgcttgcattgtgctgggtcctcaccaatatcgttgccctgactcacacgttcctc
atggctcggttgtccttctgtgtgactggggaaattgctcactttttctgtgacatcact
cctgtcctgaagctgtcatgttctgacacccacatcaacgagatgatggtttttgtcttg
ggaggcaccgtactcatcgtcccctttttatgcattgtcacctcctacatccacattgtg
ccagctatcctgagggtccgaacccgtggtggggtgggcaaggccttttccacctgcagt
tcccacctctgcgttgtttgtgtgttctatgggaccctcttcagtgcctacctgtgtcct
ccctccattgcctctgaagagaaggacattgcagcagctgcaatgtacaccatagtgact
cccatgttgaacccctttatctatagcctaaggaacaaggacatgaagggggccctaaag
aggctcttcagtcacaggagtattgtttcctcttag

DBGET integrated database retrieval system