KEGG   Homo sapiens (human): 1394Help
Entry
1394              CDS       T01001                                 

Gene name
CRHR1, CRF-R, CRF-R-1, CRF-R1, CRF1, CRFR-1, CRFR1, CRH-R-1, CRH-R1, CRH-R1h, CRHR, CRHR1L, CRHR1f
Definition
corticotropin releasing hormone receptor 1
Orthology
K04578  
corticotropin releasing hormone receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Long-term depression
Drug target
Corticorelin: 
Other: 
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:hsa04080]
Organismal Systems; Nervous system; Long-term depression [PATH:hsa04730]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q12-q22
AA seq 444 aa AA seqDB search
MGGHPQLRLVKALLLLGLNPVSASLQDQHCESLSLASNISGLQCNASVDLIGTCWPRSPA
GQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAV
IINYLGHCISLVALLVAFVLFLRLRPGCTHWGDQADGALEVGAPWSGAPFQVRRSIRCLR
NIIHWNLISAFILRNATWFVVQLTMSPEVHQSNVGWCRLVTAAYNYFHVTNFFWMFGEGC
YLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYI
YQGPMILVLLINFIFLFNIVRILMTKLRASTTSETIQYRKAVKATLVLLPLLGITYMLFF
VNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRKRWHRWQDKHSIRARV
ARAMSIPTSPTRVSFHSIKQSTAV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgggagggcacccgcagctccgtctcgtcaaggcccttctccttctggggctgaacccc
gtctctgcctccctccaggaccagcactgcgagagcctgtccctggccagcaacatctca
ggactgcagtgcaacgcatccgtggacctcattggcacctgctggccccgcagccctgcg
gggcagctagtggttcggccctgccctgcctttttctatggtgtccgctacaataccaca
aacaatggctaccgggagtgcctggccaatggcagctgggccgcccgcgtgaattactcc
gagtgccaggagatcctcaatgaggagaaaaaaagcaaggtgcactaccatgtcgcagtc
atcatcaactacctgggccactgtatctccctggtggccctcctggtggcctttgtcctc
tttctgcggctcaggccaggctgcacccattggggtgaccaggcagatggagccctggag
gtgggggctccatggagtggtgccccatttcaggttcgaaggagcatccggtgcctgcga
aacatcatccactggaacctcatctccgccttcatcctgcgcaacgccacctggttcgtg
gtccagctaaccatgagccccgaggtccaccagagcaacgtgggctggtgcaggttggtg
acagccgcctacaactacttccatgtgaccaacttcttctggatgttcggcgagggctgc
tacctgcacacagccatcgtgctcacctactccactgaccggctgcgcaaatggatgttc
atctgcattggctggggtgtgcccttccccatcattgtggcctgggccattgggaagctg
tactacgacaatgagaagtgctggtttggcaaaaggcctggggtgtacaccgactacatc
taccagggccccatgatcctggtcctgctgatcaatttcatcttccttttcaacatcgtc
cgcatcctcatgaccaagctccgggcatccaccacgtctgagaccattcagtacaggaag
gctgtgaaagccactctggtgctgctgcccctcctgggcatcacctacatgctgttcttc
gtcaatcccggggaggatgaggtctcccgggtcgtcttcatctacttcaactccttcctg
gaatccttccagggcttctttgtgtctgtgttctactgtttcctcaatagtgaggtccgt
tctgccatccggaagaggtggcaccggtggcaggacaagcactcgatccgtgcccgagtg
gcccgtgccatgtccatccccacctccccaacccgtgtcagctttcacagcatcaagcag
tccacagcagtctga

DBGET integrated database retrieval system