KEGG   Homo sapiens (human): 1395Help
Entry
1395              CDS       T01001                                 

Gene name
CRHR2, CRF-RB, CRF2, CRFR2, HM-CRF
Definition
(RefSeq) corticotropin releasing hormone receptor 2
  KO
K04579  
corticotropin releasing hormone receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
Neuroactive ligand-receptor interaction
Drug target
Corticorelin (DG01167): 
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1395 (CRHR2)
G protein-coupled receptors [BR:hsa04030]
 Class B. Secretin receptor family
  Hypothalamic hormone
   Corticotropin-releasing hormone
    1395 (CRHR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
Q13324(Tbio)
UniProt: 
Structure
PDB: 

Jmol
Position
7p14.3
AA seq 411 aa AA seqDB search
MDAALLHSLLEANCSLALAEELLLDGWGPPLDPEGPYSYCNTTLDQIGTCWPRSAAGALV
ERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVN
YLGHCVSVAALVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVMWFLLQLVDHEVHESN
EVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIV
AWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTS
ETIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYC
FFNGEVRSAVRKRWHRWQDHHSLRVPMARAMSIPTSPTRISFHSIKQTAAV
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggacgcggcactgctccacagcctgctggaggccaactgcagcctggcgctggctgaa
gagctgctcttggacggctgggggccacccctggaccccgagggtccctactcctactgc
aacacgaccttggaccagatcggaacgtgctggccccgcagcgctgccggagccctcgtg
gagaggccgtgccccgagtacttcaacggcgtcaagtacaacacgacccggaatgcctat
cgagaatgcttggagaatgggacgtgggcctcaaagatcaactactcacagtgtgagccc
attttggatgacaagcagaggaagtatgacctgcactaccgcatcgcccttgtcgtcaac
tacctgggccactgcgtatctgtggcagccctggtggccgccttcctgcttttcctggcc
ctgcggagcattcgctgtctgcggaatgtgattcactggaacctcatcaccacctttatc
ctgcgaaatgtcatgtggttcctgctgcagctcgttgaccatgaagtgcacgagagcaat
gaggtctggtgccgctgcatcaccaccatcttcaactacttcgtggtgaccaacttcttc
tggatgtttgtggaaggctgctacctgcacacggccattgtcatgacctactccactgag
cgcctgcgcaagtgcctcttcctcttcatcggatggtgcatccccttccccatcatcgtc
gcctgggccatcggcaagctctactatgagaatgaacagtgctggtttggcaaggagcct
ggcgacctggtggactacatctaccaaggccccatcattctcgtgctcctgatcaatttc
gtatttctgttcaacatcgtcaggatcctaatgacaaagttacgcgcgtccaccacatcc
gagacaatccagtacaggaaggcagtgaaggccaccctggtgctcctgcccctcctgggc
atcacctacatgctcttcttcgtcaatcccggggaggacgacctgtcacagatcatgttc
atctatttcaactccttcctgcagtcgttccagggtttcttcgtgtctgtcttctactgc
ttcttcaatggagaggtgcgctcagccgtgaggaagaggtggcaccgctggcaggaccat
cactcccttcgagtccccatggcccgggccatgtccatccctacatcacccacacggatc
agcttccacagcatcaagcagacggccgctgtgtga

DBGET integrated database retrieval system