KEGG   Homo sapiens (human): 1399Help
Entry
1399              CDS       T01001                                 

Gene name
CRKL
Definition
v-crk avian sarcoma virus CT10 oncogene homolog-like
Orthology
K04438  
proto-oncogene C-crk
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Focal adhesion
Fc gamma R-mediated phagocytosis
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Bacterial invasion of epithelial cells
Shigellosis
Pathways in cancer
MicroRNAs in cancer
Renal cell carcinoma
Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    1399 (CRKL)
   04010 MAPK signaling pathway
    1399 (CRKL)
   04012 ErbB signaling pathway
    1399 (CRKL)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    1399 (CRKL)
  Cell communication
   04510 Focal adhesion
    1399 (CRKL)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    1399 (CRKL)
   04062 Chemokine signaling pathway
    1399 (CRKL)
  Endocrine system
   04910 Insulin signaling pathway
    1399 (CRKL)
  Nervous system
   04722 Neurotrophin signaling pathway
    1399 (CRKL)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    1399 (CRKL)
   05206 MicroRNAs in cancer
    1399 (CRKL)
   05220 Chronic myeloid leukemia
    1399 (CRKL)
   05211 Renal cell carcinoma
    1399 (CRKL)
  Infectious diseases
   05131 Shigellosis
    1399 (CRKL)
   05100 Bacterial invasion of epithelial cells
    1399 (CRKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.21
AA seq 303 aa AA seqDB search
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcggaccgctccgcctggtatatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctcgtccgcgat
tcttccacctgccctggggactatgtgctgtcggtgtccgagaactcgcgggtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggaatttgaccat
ttgccggccctgctggagttttacaagatccactacctggacaccaccaccctcatcgag
cctgcgcccaggtatccaagcccaccaatgggatctgtctcagcacccaacctgcctaca
gcagaagataacctggaatatgtacggactctgtatgattttcctgggaatgatgccgaa
gacctgccctttaaaaagggtgagatcctagtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaggatggccgggttgggatgattcctgtcccttatgtcgaaaag
cttgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttatgggatc
ccagaacctgctcatgcatacgctcaacctcagaccacaactcctctacctgcagtttcc
ggttctcctggggcagcaatcacccctttgccatccacacagaatggacctgtctttgcg
aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattagaggtt
ggtgacatcgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaagtgaac
gggcgcaaagggcttttcccctttacgcacgtcaaaatctttgaccctcaaaacccagat
gaaaacgagtga

DBGET integrated database retrieval system