KEGG   Homo sapiens (human): 1399Help
Entry
1399              CDS       T01001                                 

Gene name
CRKL
Definition
v-crk avian sarcoma virus CT10 oncogene homolog-like
Orthology
K04438  
proto-oncogene C-crk
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Rap1 signaling pathway
Chemokine signaling pathway
Focal adhesion
Fc gamma R-mediated phagocytosis
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
Bacterial invasion of epithelial cells
Shigellosis
Pathways in cancer
MicroRNAs in cancer
Renal cell carcinoma
Chronic myeloid leukemia
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:hsa04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:hsa04012]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:hsa04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:hsa04510]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:hsa04666]
Organismal Systems; Immune system; Chemokine signaling pathway [PATH:hsa04062]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:hsa04910]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:hsa04722]
Human Diseases; Cancers; Pathways in cancer [PATH:hsa05200]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
Human Diseases; Cancers; Chronic myeloid leukemia [PATH:hsa05220]
Human Diseases; Cancers; Renal cell carcinoma [PATH:hsa05211]
Human Diseases; Infectious diseases; Shigellosis [PATH:hsa05131]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:hsa05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
22q11.21
AA seq 303 aa AA seqDB search
MSSARFDSSDRSAWYMGPVSRQEAQTRLQGQRHGMFLVRDSSTCPGDYVLSVSENSRVSH
YIINSLPNRRFKIGDQEFDHLPALLEFYKIHYLDTTTLIEPAPRYPSPPMGSVSAPNLPT
AEDNLEYVRTLYDFPGNDAEDLPFKKGEILVIIEKPEEQWWSARNKDGRVGMIPVPYVEK
LVRSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPSTQNGPVFA
KAIQKRVPCAYDKTALALEVGDIVKVTRMNINGQWEGEVNGRKGLFPFTHVKIFDPQNPD
ENE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccgccaggttcgactcctcggaccgctccgcctggtatatggggccggtgtct
cgccaggaggcgcagacccggctccagggccagcgccacggtatgttcctcgtccgcgat
tcttccacctgccctggggactatgtgctgtcggtgtccgagaactcgcgggtctcccac
tacatcatcaactcgctgcccaaccgccgttttaagatcggggaccaggaatttgaccat
ttgccggccctgctggagttttacaagatccactacctggacaccaccaccctcatcgag
cctgcgcccaggtatccaagcccaccaatgggatctgtctcagcacccaacctgcctaca
gcagaagataacctggaatatgtacggactctgtatgattttcctgggaatgatgccgaa
gacctgccctttaaaaagggtgagatcctagtgataatagagaagcctgaagaacagtgg
tggagtgcccggaacaaggatggccgggttgggatgattcctgtcccttatgtcgaaaag
cttgtgagatcctcaccacacggaaagcatggaaataggaattccaacagttatgggatc
ccagaacctgctcatgcatacgctcaacctcagaccacaactcctctacctgcagtttcc
ggttctcctggggcagcaatcacccctttgccatccacacagaatggacctgtctttgcg
aaagcaatccagaaaagagtaccctgtgcttatgacaagactgccttggcattagaggtt
ggtgacatcgtgaaagtcacaaggatgaatataaatggccagtgggaaggcgaagtgaac
gggcgcaaagggcttttcccctttacgcacgtcaaaatctttgaccctcaaaacccagat
gaaaacgagtga

DBGET integrated database retrieval system