KEGG   Homo sapiens (human): 14Help
Entry
14                CDS       T01001                                 

Gene name
AAMP
Definition
(RefSeq) angio associated migratory cell protein
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q35
AA seq 434 aa AA seqDB search
MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEG
NEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWR
LSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWM
EWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIR
IWDLKQGSPIHVLKGTEGHQGPLTCVAANQDGSLILTGSVDCQAKLVSATTGKVVGVFRP
ETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDGTLAIYDLATQTLRHQCQHQSG
IVQLLWEAGTAVVYTCSLDGIVRLWDARTGRLLTDYRGHTAEILDFALSKDASLVVTTSG
DHKAKVFCVQRPDR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgaatcggaaagcggggctgctgctgacacccccccactggagaccctaagc
ttccatggtgatgaagagattatcgaggtggtagaacttgatcccggtccgccggaccca
gatgacctggcccaggagatggaagatgtggactttgaggaagaagaggaggaagagggc
aacgaagagggctgggttctagaaccccaggaaggggtggtcggcagcatggagggcccc
gacgatagcgaggtcacctttgcattgcactcagcatctgtgttttgtgtgagcctggac
cccaagaccaataccttggcagtgaccgggggtgaagatgacaaagccttcgtatggcgg
ctcagcgatggggagctgctctttgagtgtgcaggccataaagactctgtgacttgtgct
ggtttcagccatgactccactctagtggccacaggggacatgagtggcctcttgaaagtg
tggcaggtggacactaaggaggaggtctggtcctttgaagcgggagacctggagtggatg
gagtggcatcctcgggcacctgtcctgttggcgggcacagctgacggcaacacctggatg
tggaaagtcccgaatggtgactgcaagaccttccagggtcccaactgcccagccacctgt
ggccgagtcctccctgatgggaagagagctgtggtaggctatgaagatgggaccatcagg
atttgggacctgaagcagggaagccctatccatgtactgaaagggactgagggtcaccag
ggcccactcacctgtgttgctgccaaccaggatggcagcttgatcctaactggctctgtg
gactgccaggccaagctggtcagtgccaccaccggcaaggtggtgggtgtttttagacct
gagactgtggcctcccagcccagcctgggagaaggggaggagagtgagtccaactcggtg
gagtccttgggcttctgcagtgtgatgcccctggcagctgttggctacctggatgggacc
ttggccatctatgacctggctacgcagactcttaggcatcagtgtcagcaccagtcgggc
atcgtgcagctgctgtgggaggcaggcactgccgtggtatatacctgcagcctggatggc
atcgtgcgcctctgggacgcccggaccggccgcctgcttactgactaccggggccacacg
gctgagatcctggactttgccctcagcaaagatgcctccctggtggtgaccacgtcagga
gaccacaaagcgaaagtattttgtgtccaaaggcctgaccgttaa

DBGET integrated database retrieval system