KEGG   Homo sapiens (human): 1401Help
Entry
1401              CDS       T01001                                 

Gene name
CRP, PTX1
Definition
(RefSeq) C-reactive protein
  KO
K16143  
C-reactive protein
Organism
hsa  Homo sapiens (human)
Disease
H00080  
Systemic lupus erythematosus
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q23.2
AA seq 224 aa AA seqDB search
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctgttgtgtttcttggtcttgaccagcctctctcatgcttttggccagaca
gacatgtcgaggaaggcttttgtgtttcccaaagagtcggatacttcctatgtatccctc
aaagcaccgttaacgaagcctctcaaagccttcactgtgtgcctccacttctacacggaa
ctgtcctcgacccgtgggtacagtattttctcgtatgccaccaagagacaagacaatgag
attctcatattttggtctaaggatataggatacagttttacagtgggtgggtctgaaata
ttattcgaggttcctgaagtcacagtagctccagtacacatttgtacaagctgggagtcc
gcctcagggatcgtggagttctgggtagatgggaagcccagggtgaggaagagtctgaag
aagggatacactgtgggggcagaagcaagcatcatcttggggcaggagcaggattccttc
ggtgggaactttgaaggaagccagtccctggtgggagacattggaaatgtgaacatgtgg
gactttgtgctgtcaccagatgagattaacaccatctatcttggcgggcccttcagtcct
aatgtcctgaactggcgggcactgaagtatgaagtgcaaggcgaagtgttcaccaaaccc
cagctgtggccctga

DBGET integrated database retrieval system