KEGG   Homo sapiens (human): 1401Help
Entry
1401              CDS       T01001                                 

Gene name
CRP, PTX1
Definition
(RefSeq) C-reactive protein
  KO
K16143  C-reactive protein
Organism
hsa  Homo sapiens (human)
Disease
H00080  Systemic lupus erythematosus
SSDB OrthologParalogGFIT
Motif
Pfam: Pentaxin Laminin_G_3
Motif
Other DBs
NCBI-GeneID: 1401
NCBI-ProteinID: NP_000558
OMIM: 123260
HGNC: 2367
Ensembl: ENSG00000132693
Vega: OTTHUMG00000035344
Pharos: P02741(Tbio)
UniProt: P02741
Structure
PDB: 

Jmol
Position
1q23.2
AA seq 224 aa AA seqDB search
MEKLLCFLVLTSLSHAFGQTDMSRKAFVFPKESDTSYVSLKAPLTKPLKAFTVCLHFYTE
LSSTRGYSIFSYATKRQDNEILIFWSKDIGYSFTVGGSEILFEVPEVTVAPVHICTSWES
ASGIVEFWVDGKPRVRKSLKKGYTVGAEASIILGQEQDSFGGNFEGSQSLVGDIGNVNMW
DFVLSPDEINTIYLGGPFSPNVLNWRALKYEVQGEVFTKPQLWP
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggagaagctgttgtgtttcttggtcttgaccagcctctctcatgcttttggccagaca
gacatgtcgaggaaggcttttgtgtttcccaaagagtcggatacttcctatgtatccctc
aaagcaccgttaacgaagcctctcaaagccttcactgtgtgcctccacttctacacggaa
ctgtcctcgacccgtgggtacagtattttctcgtatgccaccaagagacaagacaatgag
attctcatattttggtctaaggatataggatacagttttacagtgggtgggtctgaaata
ttattcgaggttcctgaagtcacagtagctccagtacacatttgtacaagctgggagtcc
gcctcagggatcgtggagttctgggtagatgggaagcccagggtgaggaagagtctgaag
aagggatacactgtgggggcagaagcaagcatcatcttggggcaggagcaggattccttc
ggtgggaactttgaaggaagccagtccctggtgggagacattggaaatgtgaacatgtgg
gactttgtgctgtcaccagatgagattaacaccatctatcttggcgggcccttcagtcct
aatgtcctgaactggcgggcactgaagtatgaagtgcaaggcgaagtgttcaccaaaccc
cagctgtggccctga

DBGET integrated database retrieval system