KEGG   Homo sapiens (human): 1404Help
Entry
1404              CDS       T01001                                 

Gene name
HAPLN1, CRTL1
Definition
hyaluronan and proteoglycan link protein 1
Orthology
K06848  
hyaluronan and proteoglycan link protein 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
5q14.3
AA seq 354 aa AA seqDB search
MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLP
CKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDS
DASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQA
CLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGF
WDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILG
YDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaagagtctacttcttctggtgctgatttcaatctgctgggctgatcatctttcagac
aactatactctggatcatgacagagctattcacatccaagcagaaaatggcccccatcta
cttgtggaagcagagcaagccaaggtgttttcacacagaggtggcaatgttacactgcca
tgtaaattttatcgagaccctacagcatttggctcaggaatccataaaatccgaattaag
tggaccaagctaacttcggattacctcaaggaagtggatgtttttgtttccatgggatac
cacaaaaaaacctatggaggctaccagggtagagtgtttctgaagggaggcagtgatagt
gatgcttctctggtcatcacagacctcactctggaagattatgggagatataagtgtgag
gtgattgaaggattagaagatgatactgttgtggtagcactggacttacaaggtgtggta
ttcccttactttccacgactggggcgctacaatctcaattttcacgaggcgcagcaggcg
tgtctggaccaggatgctgtgatcgcctccttcgaccagctgtacgacgcctggcggggc
gggctggactggtgcaatgccggctggctcagtgatggctctgtgcaatatcccatcaca
aagcccagagagccctgtggggggcagaacacagtgcccggagtcaggaactacggattt
tgggataaagataaaagcagatatgatgttttctgttttacatccaatttcaatggccgt
ttttactatctgatccaccccaccaaactgacctatgatgaagcggtgcaagcttgtctc
aatgatggtgctcagattgcaaaagtgggccagatatttgctgcctggaaaattctcgga
tatgaccgctgtgatgcgggctggttggcggatggcagcgtccgctaccccatctctagg
ccaagaaggcgctgcagtcctactgaggctgcagtgcgcttcgtgggtttcccagataaa
aagcataagctgtatggtgtctactgcttcagagcatacaactga

DBGET integrated database retrieval system