KEGG   Homo sapiens (human): 140453Help
Entry
140453            CDS       T01001                                 

Gene name
MUC17, MUC3
Definition
mucin 17, cell surface associated
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q22.1
AA seq 4493 aa AA seqDB search
MPRPGTMALCLLTLVLSLLPPQAAAEQDLSVNRAVWDGGGCISQGDVLNRQCQQLSQHVR
TGSAANTATGTTSTNVVEPRMYLSCSTNPEMTSIESSVTSDTPGVSSTRMTPTESRTTSE
STSDSTTLFPSSTEDTSSPTTPEGTDVPMSTPSEESISSTMAFVSTAPLPSFEAYTSLTY
KVDMSTPLTTSTQASSSPTTPESTTIPKSTNSEGSTPLTSMPASTMKVASSEAITLLTTP
VEISTPVTISAQASSSPTTAEGPSLSNSAPSGGSTPLTRMPLSVMLVVSSEASTLSTTPA
ATNIPVITSTEASSSPTTAEGTSIPTSTYTEGSTPLTSTPASTMPVATSEMSTLSITPVD
TSTLVTTSTEPSSLPTTAEATSMLTSTLSEGSTPLTNMPVSTILVASSEASTTSTIPVDS
KTFVTTASEASSSPTTAEDTSIATSTPSEGSTPLTSMPVSTTPVASSEASNLSTTPVDSK
TQVTTSTEASSSPPTAEVNSMPTSTPSEGSTPLTSMSVSTMPVASSEASTLSTTPVDTST
PVTTSSEASSSSTTPEGTSIPTSTPSEGSTPLTNMPVSTRLVVSSEASTTSTTPADSNTF
VTTSSEASSSSTTAEGTSMPTSTYSERGTTITSMSVSTTLVASSEASTLSTTPVDSNTPV
TTSTEATSSSTTAEGTSMPTSTYTEGSTPLTSMPVNTTLVASSEASTLSTTPVDTSTPVT
TSTEASSSPTTADGASMPTSTPSEGSTPLTSMPVSKTLLTSSEASTLSTTPLDTSTHITT
STEASCSPTTTEGTSMPISTPSEGSPLLTSIPVSITPVTSPEASTLSTTPVDSNSPVTTS
TEVSSSPTPAEGTSMPTSTYSEGRTPLTSMPVSTTLVATSAISTLSTTPVDTSTPVTNST
EARSSPTTSEGTSMPTSTPGEGSTPLTSMPDSTTPVVSSEARTLSATPVDTSTPVTTSTE
ATSSPTTAEGTSIPTSTPSEGTTPLTSTPVSHTLVANSEASTLSTTPVDSNTPLTTSTEA
SSPPPTAEGTSMPTSTPSEGSTPLTRMPVSTTMVASSETSTLSTTPADTSTPVTTYSQAS
SSSTTADGTSMPTSTYSEGSTPLTSVPVSTRLVVSSEASTLSTTPVDTSIPVTTSTEASS
SPTTAEGTSIPTSPPSEGTTPLASMPVSTTLVVSSEANTLSTTPVDSKTQVATSTEASSP
PPTAEVTSMPTSTPGERSTPLTSMPVRHTPVASSEASTLSTSPVDTSTPVTTSAETSSSP
TTAEGTSLPTSTTSEGSTLLTSIPVSTTLVTSPEASTLLTTPVDTKGPVVTSNEVSSSPT
PAEGTSMPTSTYSEGRTPLTSIPVNTTLVASSAISILSTTPVDNSTPVTTSTEACSSPTT
SEGTSMPNSNPSEGTTPLTSIPVSTTPVVSSEASTLSATPVDTSTPGTTSAEATSSPTTA
EGISIPTSTPSEGKTPLKSIPVSNTPVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPAE
GTSIAISTPSEGSTALTSIPVSTTTVASSEINSLSTTPAVTSTPVTTYSQASSSPTTADG
TSMQTSTYSEGSTPLTSLPVSTMLVVSSEANTLSTTPIDSKTQVTASTEASSSTTAEGSS
MTISTPSEGSPLLTSIPVSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPTPAEGTSM
PTSTYTEGRTPLTSITVRTTPVASSAISTLSTTPVDNSTPVTTSTEARSSPTTSEGTSMP
NSTPSEGTTPLTSIPVSTTPVLSSEASTLSATPIDTSTPVTTSTEATSSPTTAEGTSIPT
STLSEGMTPLTSTPVSHTLVANSEASTLSTTPVDSNSPVVTSTAVSSSPTPAEGTSIATS
TPSEGSTALTSIPVSTTTVASSETNTLSTTPAVTSTPVTTYAQVSSSPTTADGSSMPTST
PREGRPPLTSIPVSTTTVASSEINTLSTTLADTRTPVTTYSQASSSPTTADGTSMPTPAY
SEGSTPLTSMPLSTTLVVSSEASTLSTTPVDTSTPATTSTEGSSSPTTAGGTSIQTSTPS
ERTTPLAGMPVSTTLVVSSEGNTLSTTPVDSKTQVTNSTEASSSATAEGSSMTISAPSEG
SPLLTSIPLSTTPVASPEASTLSTTPVDSNSPVITSTEVSSSPIPTEGTSMQTSTYSDRR
TPLTSMPVSTTVVASSAISTLSTTPVDTSTPVTNSTEARSSPTTSEGTSMPTSTPSEGST
PFTSMPVSTMPVVTSEASTLSATPVDTSTPVTTSTEATSSPTTAEGTSIPTSTLSEGTTP
LTSIPVSHTLVANSEVSTLSTTPVDSNTPFTTSTEASSPPPTAEGTSMPTSTSSEGNTPL
TRMPVSTTMVASFETSTLSTTPADTSTPVTTYSQAGSSPTTADDTSMPTSTYSEGSTPLT
SVPVSTMPVVSSEASTHSTTPVDTSTPVTTSTEASSSPTTAEGTSIPTSPPSEGTTPLAS
MPVSTTPVVSSEAGTLSTTPVDTSTPMTTSTEASSSPTTAEDIVVPISTASEGSTLLTSI
PVSTTPVASPEASTLSTTPVDSNSPVVTSTEISSSATSAEGTSMPTSTYSEGSTPLRSMP
VSTKPLASSEASTLSTTPVDTSIPVTTSTETSSSPTTAKDTSMPISTPSEVSTSLTSILV
STMPVASSEASTLSTTPVDTRTLVTTSTGTSSSPTTAEGSSMPTSTPGERSTPLTNILVS
TTLLANSEASTLSTTPVDTSTPVTTSAEASSSPTTAEGTSMRISTPSDGSTPLTSILVST
LPVASSEASTVSTTAVDTSIPVTTSTEASSSPTTAEVTSMPTSTPSETSTPLTSMPVNHT
PVASSEAGTLSTTPVDTSTPVTTSTKASSSPTTAEGIVVPISTASEGSTLLTSIPVSTTP
VASSEASTLSTTPVDTSIPVTTSTEGSSSPTTAEGTSMPISTPSEVSTPLTSILVSTVPV
AGSEASTLSTTPVDTRTPVTTSAEASSSPTTAEGTSMPISTPGERRTPLTSMSVSTMPVA
SSEASTLSRTPADTSTPVTTSTEASSSPTTAEGTGIPISTPSEGSTPLTSIPVSTTPVAI
PEASTLSTTPVDSNSPVVTSTEVSSSPTPAEGTSMPISTYSEGSTPLTGVPVSTTPVTSS
AISTLSTTPVDTSTPVTTSTEAHSSPTTSEGTSMPTSTPSEGSTPLTYMPVSTMLVVSSE
DSTLSATPVDTSTPVTTSTEATSSTTAEGTSIPTSTPSEGMTPLTSVPVSNTPVASSEAS
ILSTTPVDSNTPLTTSTEASSSPPTAEGTSMPTSTPSEGSTPLTSMPVSTTTVASSETST
LSTTPADTSTPVTTYSQASSSPPIADGTSMPTSTYSEGSTPLTNMSFSTTPVVSSEASTL
STTPVDTSTPVTTSTEASLSPTTAEGTSIPTSSPSEGTTPLASMPVSTTPVVSSEVNTLS
TTPVDSNTLVTTSTEASSSPTIAEGTSLPTSTTSEGSTPLSIMPLSTTPVASSEASTLST
TPVDTSTPVTTSSPTNSSPTTAEVTSMPTSTAGEGSTPLTNMPVSTTPVASSEASTLSTT
PVDSNTFVTSSSQASSSPATLQVTTMRMSTPSEGSSSLTTMLLSSTYVTSSEASTPSTPS
VDRSTPVTTSTQSNSTPTPPEVITLPMSTPSEVSTPLTIMPVSTTSVTISEAGTASTLPV
DTSTPVITSTQVSSSPVTPEGTTMPIWTPSEGSTPLTTMPVSTTRVTSSEGSTLSTPSVV
TSTPVTTSTEAISSSATLDSTTMSVSMPMEISTLGTTILVSTTPVTRFPESSTPSIPSVY
TSMSMTTASEGSSSPTTLEGTTTMPMSTTSERSTLLTTVLISPISVMSPSEASTLSTPPG
DTSTPLLTSTKAGSFSIPAEVTTIRISITSERSTPLTTLLVSTTLPTSFPGASIASTPPL
DTSTTFTPSTDTASTPTIPVATTISVSVITEGSTPGTTIFIPSTPVTSSTADVFPATTGA
VSTPVITSTELNTPSTSSSSTTTSFSTTKEFTTPAMTTAAPLTYVTMSTAPSTPRTTSRG
CTTSASTLSATSTPHTSTSVTTRPVTPSSESSRPSTITSHTIPPTFPPAHSSTPPTTSAS
STTVNPEAVTTMTTRTKPSTRTTSFPTVTTTAVPTNTTIKSNPTSTPTVPRTTTCFGDGC
QNTASRCKNGGTWDGLKCQCPNLYYGELCEEVVSSIDIGPPETISAQMELTVTVTSVKFT
EELKNHSSQEFQEFKQTFTEQMNIVYSGIPEYVGVNITKLRLGSVVVEHDVLLRTKYTPE
YKTVLDNATEVVKEKITKVTTQQIMINDICSDMMCFNTTGTQVQNITVTQYDPEEDCRKM
AKEYGDYFVVEYRDQKPYCISPCEPGFSVSKNCNLGKCQMSLSGPQCLCVTTETHWYSGE
TCNQGTQKSLVYGLVGAGVVLMLIILVALLMLVFRSKREVKRQKYRLSQLYKWQEEDSGP
APGTFQNIGFDICQDDDSIHLESIYSNFQPSLRHIDPETKIRIQRPQVMTTSF
NT seq 13482 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggccagggaccatggcgctgtgtctgctgaccttggtcctctcgctcttgccc
ccacaagctgctgcagaacaggacctcagtgtgaacagggctgtgtgggatggaggaggg
tgcatctcccaaggggacgtcttgaaccgtcagtgccagcagctgtctcagcacgttagg
acaggttctgcggcaaacaccgccacaggtacaacatctacaaatgtcgtggagccaaga
atgtatttgagttgcagcaccaaccctgagatgacctcgattgagtccagtgtgacttca
gacactcctggtgtctccagtaccaggatgacaccaacagaatccagaacaacttcagaa
tctaccagtgacagcaccacacttttccccagttctactgaagacacttcatctcctaca
actcctgaaggcaccgacgtgcccatgtcaacaccaagtgaagaaagcatttcatcaaca
atggcttttgtcagcactgcacctcttcccagttttgaggcctacacatctttaacatat
aaggttgatatgagcacacctctgaccacttctactcaggcaagttcatctcctactact
cctgaaagcaccaccatacccaaatcaactaacagtgaaggaagcactccattaacaagt
atgcctgccagcaccatgaaggtggccagttcagaggctatcacccttttgacaactcct
gttgaaatcagcacacctgtgaccatttctgctcaagccagttcatctcctacaactgct
gaaggtcccagcctgtcaaactcagctcctagtggaggaagcactccattaacaagaatg
cctctcagcgtgatgctggtggtcagttctgaggctagcaccctttcaacaactcctgct
gccaccaacattcctgtgatcacttctactgaagccagttcatctcctacaacggctgaa
ggcaccagcataccaacctcaacttatactgaaggaagcactccattaacaagtacgcct
gccagcaccatgccggttgccacttctgaaatgagcacactttcaataactcctgttgac
accagcacacttgtgaccacttctactgaacccagttcacttcctacaactgctgaagct
accagcatgctaacctcaactcttagtgaaggaagcactccattaacaaatatgcctgtc
agcaccatattggtggccagttctgaggctagcaccacttcaacaattcctgttgactcc
aaaacttttgtgaccactgctagtgaagccagctcatctcccacaactgctgaagatacc
agcattgcaacctcaactcctagtgaaggaagcactccattaacaagtatgcctgtcagc
accactccagtggccagttctgaggctagcaacctttcaacaactcctgttgactccaaa
actcaggtgaccacttctactgaagccagttcatctcctccaactgctgaagttaacagc
atgccaacctcaactcctagtgaaggaagcactccattaacaagtatgtctgtcagcacc
atgccggtggccagttctgaggctagcaccctttcaacaactcctgttgacaccagcaca
cctgtgaccacttctagtgaagccagttcatcttctacaactcctgaaggtaccagcata
ccaacctcaactcctagtgaaggaagcactccattaacaaacatgcctgtcagcaccagg
ctggtggtcagttctgaggctagcaccacttcaacaactcctgctgactccaacactttt
gtgaccacttctagtgaagctagttcatcttctacaactgctgaaggtaccagcatgcca
acctcaacttacagtgaaagaggcactacaataacaagtatgtctgtcagcaccacactg
gtggccagttctgaggctagcaccctttcaacaactcctgttgactccaacactcctgtg
accacttcaactgaagccacttcatcttctacaactgcggaaggtaccagcatgccaacc
tcaacttatactgaaggaagcactccattaacaagtatgcctgtcaacaccacactggtg
gccagttctgaggctagcaccctttcaacaactcctgttgacaccagcacacctgtgacc
acttcaactgaagccagttcctctcctacaactgctgatggtgccagtatgccaacctca
actcctagtgaaggaagcactccattaacaagtatgcctgtcagcaaaacgctgttgacc
agttctgaggctagcaccctttcaacaactcctcttgacacaagcacacatatcaccact
tctactgaagccagttgctctcctacaaccactgaaggtaccagcatgccaatctcaact
cctagtgaaggaagtcctttattaacaagtatacctgtcagcatcacaccggtgaccagt
cctgaggctagcaccctttcaacaactcctgttgactccaacagtcctgtgaccacttct
actgaagtcagttcatctcctacacctgctgaaggtaccagcatgccaacctcaacttat
agtgaaggaagaactcctttaacaagtatgcctgtcagcaccacactggtggccacttct
gcaatcagcaccctttcaacaactcctgttgacaccagcacacctgtgaccaattctact
gaagcccgttcgtctcctacaacttctgaaggtaccagcatgccaacctcaactcctggg
gaaggaagcactccattaacaagtatgcctgacagcaccacgccggtagtcagttctgag
gctagaacactttcagcaactcctgttgacaccagcacacctgtgaccacttctactgaa
gccacttcatctcctacaactgctgaaggtaccagcataccaacctcgactcctagtgaa
ggaacgactccattaacaagcacacctgtcagccacacgctggtggccaattctgaggct
agcaccctttcaacaactcctgttgactccaacactcctttgaccacttctactgaagcc
agttcacctcctcccactgctgaaggtaccagcatgccaacctcaactcctagtgaagga
agcactccattaacacgtatgcctgtcagcaccacaatggtggccagttctgaaacgagc
acactttcaacaactcctgctgacaccagcacacctgtgaccacttattctcaagccagt
tcatcttctacaactgctgacggtaccagcatgccaacctcaacttatagtgaaggaagc
actccactaacaagtgtgcctgtcagcaccaggctggtggtcagttctgaggctagcacc
ctttccacaactcctgtcgacaccagcatacctgtcaccacttctactgaagccagttca
tctcctacaactgctgaaggtaccagcataccaacctcacctcccagtgaaggaaccact
ccgttagcaagtatgcctgtcagcaccacgctggtggtcagttctgaggctaacaccctt
tcaacaactcctgtggactccaaaactcaggtggccacttctactgaagccagttcacct
cctccaactgctgaagttaccagcatgccaacctcaactcctggagaaagaagcactcca
ttaacaagtatgcctgtcagacacacgccagtggccagttctgaggctagcaccctttca
acatctcccgttgacaccagcacacctgtgaccacttctgctgaaaccagttcctctcct
acaaccgctgaaggtaccagcttgccaacctcaactactagtgaaggaagtactctatta
acaagtatacctgtcagcaccacgctggtgaccagtcctgaggctagcacccttttaaca
actcctgttgacactaaaggtcctgtggtcacttctaatgaagtcagttcatctcctaca
cctgctgaaggtaccagcatgccaacctcaacttatagtgaaggaagaactcctttaaca
agtatacctgtcaacaccacactggtggccagttctgcaatcagcatcctttcaacaact
cctgttgacaacagcacacctgtgaccacttctactgaagcctgttcatctcctacaact
tctgaaggtaccagcatgccaaactcaaatcctagtgaaggaaccactccgttaacaagt
atacctgtcagcaccacgccggtagtcagttctgaggctagcaccctttcagcaactcct
gttgacaccagcacccctgggaccacttctgctgaagccacttcatctcctacaactgct
gaaggtatcagcataccaacctcaactcctagtgaaggaaagactccattaaaaagtata
cctgtcagcaacacgccggtggccaattctgaggctagcaccctttcaacaactcctgtt
gactctaacagtcctgtggtcacttctacagcagtcagttcatctcctacacctgctgaa
ggtaccagcatagcaatctcaacgcctagtgaaggaagcactgcattaacaagtatacct
gtcagcaccacaacagtggccagttctgaaatcaacagcctttcaacaactcctgctgtc
accagcacacctgtgaccacttattctcaagccagttcatctcctacaactgctgacggt
accagcatgcaaacctcaacttatagtgaaggaagcactccactaacaagtttgcctgtc
agcaccatgctggtggtcagttctgaggctaacaccctttcaacaacccctattgactcc
aaaactcaggtgaccgcttctactgaagccagttcatctacaaccgctgaaggtagcagc
atgacaatctcaactcctagtgaaggaagtcctctattaacaagtatacctgtcagcacc
acgccggtggccagtcctgaggctagcaccctttcaacaactcctgttgactccaacagt
cctgtgatcacttctactgaagtcagttcatctcctacacctgctgaaggtaccagcatg
ccaacctcaacttatactgaaggaagaactcctttaacaagtataactgtcagaacaaca
ccggtggccagctctgcaatcagcaccctttcaacaactcccgttgacaacagcacacct
gtgaccacttctactgaagcccgttcatctcctacaacttctgaaggtaccagcatgcca
aactcaactcctagtgaaggaaccactccattaacaagtatacctgtcagcaccacgccg
gtactcagttctgaggctagcaccctttcagcaactcctattgacaccagcacccctgtg
accacttctactgaagccacttcgtctcctacaactgctgaaggtaccagcataccaacc
tcgactcttagtgaaggaatgactccattaacaagcacacctgtcagccacacgctggtg
gccaattctgaggctagcaccctttcaacaactcctgttgactctaacagtcctgtggtc
acttctacagcagtcagttcatctcctacacctgctgaaggtaccagcatagcaacctca
acgcctagtgaaggaagcactgcattaacaagtatacctgtcagcaccacaacagtggcc
agttctgaaaccaacaccctttcaacaactcccgctgtcaccagcacacctgtgaccact
tatgctcaagtcagttcatctcctacaactgctgacggtagcagcatgccaacctcaact
cctagggaaggaaggcctccattaacaagtatacctgtcagcaccacaacagtggccagt
tctgaaatcaacaccctttcaacaactcttgctgacaccaggacacctgtgaccacttat
tctcaagccagttcatctcctacaactgctgatggtaccagcatgccaaccccagcttat
agtgaaggaagcactccactaacaagtatgcctctcagcaccacgctggtggtcagttct
gaggctagcactctttccacaactcctgttgacaccagcactcctgccaccacttctact
gaaggcagttcatctcctacaactgcaggaggtaccagcatacaaacctcaactcctagt
gaacggaccactccattagcaggtatgcctgtcagcactacgcttgtggtcagttctgag
ggtaacaccctttcaacaactcctgttgactccaaaactcaggtgaccaattctactgaa
gccagttcatctgcaaccgctgaaggtagcagcatgacaatctcagctcctagtgaagga
agtcctctactaacaagtatacctctcagcaccacgccggtggccagtcctgaggctagc
accctttcaacaactcctgttgactccaacagtcctgtgatcacttctactgaagtcagt
tcatctcctatacctactgaaggtaccagcatgcaaacctcaacttatagtgacagaaga
actcctttaacaagtatgcctgtcagcaccacagtggtggccagttctgcaatcagcacc
ctttcaacaactcctgttgacaccagcacacctgtgaccaattctactgaagcccgttca
tctcctacaacttctgaaggtaccagcatgccaacctcaactcctagtgaaggaagcact
ccattcacaagtatgcctgtcagcaccatgccggtagttacttctgaggctagcaccctt
tcagcaactcctgttgacaccagcacacctgtgaccacttctactgaagccacttcatct
cctacaactgctgaaggtaccagcataccaacttcaactcttagtgaaggaacgactcca
ttaacaagtatacctgtcagccacacgctggtggccaattctgaggttagcaccctttca
acaactcctgttgactccaacactcctttcactacttctactgaagccagttcacctcct
cccactgctgaaggtaccagcatgccaacctcaacttctagtgaaggaaacactccatta
acacgtatgcctgtcagcaccacaatggtggccagttttgaaacaagcacactttctaca
actcctgctgacaccagcacacctgtgactacttattctcaagccggttcatctcctaca
actgctgacgatactagcatgccaacctcaacttatagtgaaggaagcactccactaaca
agtgtgcctgtcagcaccatgccggtggtcagttctgaggctagcacccattccacaact
cctgttgacaccagcacacctgtcaccacttctactgaagccagttcatctcctacaact
gctgaaggtaccagcataccaacctcacctcctagtgaaggaaccactccgttagcaagt
atgcctgtcagcaccacgccggtggtcagttctgaggctggcaccctttccacaactcct
gttgacaccagcacacctatgaccacttctactgaagccagttcatctcctacaactgct
gaagatatcgtcgtgccaatctcaactgctagtgaaggaagtactctattaacaagtata
cctgtcagcaccacgccagtggccagtcctgaggctagcaccctttcaacaactcctgtt
gactccaacagtcctgtggtcacttctactgaaatcagttcatctgctacatccgctgaa
ggtaccagcatgcctacctcaacttatagtgaaggaagcactccattaagaagtatgcct
gtcagcaccaagccgttggccagttctgaggctagcactctttcaacaactcctgttgac
accagcatacctgtcaccacttctactgaaaccagttcatctcctacaactgcaaaagat
accagcatgccaatctcaactcctagtgaagtaagtacttcattaacaagtatacttgtc
agcaccatgccagtggccagttctgaggctagcaccctttcaacaactcctgttgacacc
aggacacttgtgaccacttccactggaaccagttcatctcctacaactgctgaaggtagc
agcatgccaacctcaactcctggtgaaagaagcactccattaacaaatatacttgtcagc
accacgctgttggccaattctgaggctagcaccctttcaacaactcctgttgacaccagc
acacctgtcaccacttctgctgaagccagttcttctcctacaactgctgaaggtaccagc
atgcgaatctcaactcctagtgatggaagtactccattaacaagtatacttgtcagcacc
ctgccagtggccagttctgaggctagcaccgtttcaacaactgctgttgacaccagcata
cctgtcaccacttctactgaagccagttcctctcctacaactgctgaagttaccagcatg
ccaacctcaactcctagtgaaacaagtactccattaactagtatgcctgtcaaccacacg
ccagtggccagttctgaggctggcaccctttcaacaactcctgttgacaccagcacacct
gtgaccacttctactaaagccagttcatctcctacaactgctgaaggtatcgtcgtgcca
atctcaactgctagtgaaggaagtactctattaacaagtatacctgtcagcaccacgccg
gtggccagttctgaggctagcaccctttcaacaactcctgttgataccagcatacctgtc
accacttctactgaaggcagttcttctcctacaactgctgaaggtaccagcatgccaatc
tcaactcctagtgaagtaagtactccattaacaagtatacttgtcagcaccgtgccagtg
gccggttctgaggctagcaccctttcaacaactcctgttgacaccaggacacctgtcacc
acttctgctgaagctagttcttctcctacaactgctgaaggtaccagcatgccaatctca
actcctggcgaaagaagaactccattaacaagtatgtctgtcagcaccatgccggtggcc
agttctgaggctagcaccctttcaagaactcctgctgacaccagcacacctgtgaccact
tctactgaagccagttcctctcctacaactgctgaaggtaccggcataccaatctcaact
cctagtgaaggaagtactccattaacaagtatacctgtcagcaccacgccagtggccatt
cctgaggctagcaccctttcaacaactcctgttgactccaacagtcctgtggtcacttct
actgaagtcagttcatctcctacacctgctgaaggtaccagcatgccaatctcaacttat
agtgaaggaagcactccattaacaggtgtgcctgtcagcaccacaccggtgaccagttct
gcaatcagcaccctttcaacaactcctgttgacaccagcacacctgtgaccacttctact
gaagcccattcatctcctacaacttctgaaggtaccagcatgccaacctcaactcctagt
gaaggaagtactccattaacatatatgcctgtcagcaccatgctggtagtcagttctgag
gatagcaccctttcagcaactcctgttgacaccagcacacctgtgaccacttctactgaa
gccacttcatctacaactgctgaaggtaccagcattccaacctcaactcctagtgaagga
atgactccattaactagtgtacctgtcagcaacacgccggtggccagttctgaggctagc
atcctttcaacaactcctgttgactccaacactcctttgaccacttctactgaagccagt
tcatctcctcccactgctgaaggtaccagcatgccaacctcaactcctagtgaaggaagc
actccattaacaagtatgcctgtcagcaccacaacggtggccagttctgaaacgagcacc
ctttcaacaactcctgctgacaccagcacacctgtgaccacttattctcaagccagttca
tctcctccaattgctgacggtactagcatgccaacctcaacttatagtgaaggaagcact
ccactaacaaatatgtctttcagcaccacgccagtggtcagttctgaggctagcaccctt
tccacaactcctgttgacaccagcacacctgtcaccacttctactgaagccagtttatct
cctacaactgctgaaggtaccagcataccaacctcaagtcctagtgaaggaaccactcca
ttagcaagtatgcctgtcagcaccacgccggtggtcagttctgaggttaacaccctttca
acaactcctgtggactccaacactctggtgaccacttctactgaagccagttcatctcct
acaatcgctgaaggtaccagcttgccaacctcaactactagtgaaggaagcactccatta
tcaattatgcctctcagtaccacgccggtggccagttctgaggctagcaccctttcaaca
actcctgttgacaccagcacacctgtgaccacttcttctccaaccaattcatctcctaca
actgctgaagttaccagcatgccaacatcaactgctggtgaaggaagcactccattaaca
aatatgcctgtcagcaccacaccggtggccagttctgaggctagcaccctttcaacaact
cctgttgactccaacacttttgttaccagttctagtcaagccagttcatctccagcaact
cttcaggtcaccactatgcgtatgtctactccaagtgaaggaagctcttcattaacaact
atgctcctcagcagcacatatgtgaccagttctgaggctagcacaccttccactccttct
gttgacagaagcacacctgtgaccacttctactcagagcaattctactcctacacctcct
gaagttatcaccctgccaatgtcaactcctagtgaagtaagcactccattaaccattatg
cctgtcagcaccacatcggtgaccatttctgaggctggcacagcttcaacacttcctgtt
gacaccagcacacctgtgatcacttctacccaagtcagttcatctcctgtgactcctgaa
ggtaccaccatgccaatctggacgcctagtgaaggaagcactccattaacaactatgcct
gtcagcaccacacgtgtgaccagctctgagggtagcaccctttcaacaccttctgttgtc
accagcacacctgtgaccacttctactgaagccatttcatcttctgcaactcttgacagc
accaccatgtctgtgtcaatgcccatggaaataagcacccttgggaccactattcttgtc
agtaccacacctgttacgaggtttcctgagagtagcaccccttccataccatctgtttac
accagcatgtctatgaccactgcctctgaaggcagttcatctcctacaactcttgaaggc
accaccaccatgcctatgtcaactacgagtgaaagaagcactttattgacaactgtcctc
atcagccctatatctgtgatgagtccttctgaggccagcacactttcaacacctcctggt
gataccagcacacctttgctcacctctaccaaagccggttcattctccatacctgctgaa
gtcactaccatacgtatttcaattaccagtgaaagaagcactccattaacaactctcctt
gtcagcaccacacttccaactagctttcctggggccagcatagcttcgacacctcctctt
gacacaagcacaacttttaccccttctactgacactgcctcaactcccacaattcctgta
gccaccaccatatctgtatcagtgatcacagaaggaagcacacctgggacaaccattttt
attcccagcactcctgtcaccagttctactgctgatgtctttcctgcaacaactggtgct
gtatctacccctgtgataacttccactgaactaaacacaccatcaacctccagtagtagt
accaccacatctttttcaactactaaggaatttacaacacccgcaatgactactgcagct
cccctcacatatgtgaccatgtctactgcccccagcacacccagaacaaccagcagaggc
tgcactacttctgcatcaacgctttctgcaaccagtacacctcacacctctacttctgtc
accacccgtcctgtgaccccttcatcagaatccagcaggccgtcaacaattacttctcac
accatcccacctacatttcctcctgctcactccagtacacctccaacaacctctgcctcc
tccacgactgtgaaccctgaggctgtcaccaccatgaccaccaggacaaaacccagcaca
cggaccacttccttccccacggtgaccaccaccgctgtccccacgaatactacaattaag
agcaaccccacctcaactcctactgtgccaagaaccacaacatgctttggagatgggtgc
cagaatacggcctctcgctgcaagaatggaggcacctgggatgggctcaagtgccagtgt
cccaacctctattatggggagttgtgtgaggaggtggtcagcagcattgacatagggcca
ccggagactatctctgcccaaatggaactgactgtgacagtgaccagtgtgaagttcacc
gaagagctaaaaaaccactcttcccaggaattccaggagttcaaacagacattcacggaa
cagatgaatattgtgtattccgggatccctgagtatgtcggggtgaacatcacaaagcta
cgtcttggcagtgtggtggtggagcatgacgtcctcctaagaaccaagtacacaccagaa
tacaagacagtattggacaatgccaccgaagtagtgaaagagaaaatcacaaaagtgacc
acacagcaaataatgattaatgatatttgctcagacatgatgtgtttcaacaccactggc
acccaagtgcaaaacattacggtgacccagtacgaccctgaagaggactgccggaagatg
gccaaggaatatggagactacttcgtagtggagtaccgggaccagaagccatactgcatc
agcccctgtgagcctggcttcagtgtctccaagaactgtaacctcggcaagtgccagatg
tctctaagtggacctcagtgcctctgcgtgaccacggaaactcactggtacagtggggag
acctgtaaccagggcacccagaagagtctggtgtacggcctcgtgggggcaggggtcgtg
ctgatgctgatcatcctggtagctctcctgatgctcgttttccgctccaagagagaggtg
aaacggcaaaagtacagattgtctcagttatacaagtggcaagaagaggacagtggacca
gctcctgggaccttccaaaacattggctttgacatctgccaagatgatgattccatccac
ctggagtccatctatagtaatttccagccctccttgagacacatagaccctgaaacaaag
atccgaattcagaggcctcaggtaatgacgacatcattttaa

DBGET integrated database retrieval system