KEGG   Homo sapiens (human): 140458Help
Entry
140458            CDS       T01001                                 

Gene name
ASB5, ASB-5
Definition
ankyrin repeat and SOCS box containing 5
Orthology
K10327  
ankyrin repeat and SOCS box protein 5
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q34.2
AA seq 329 aa AA seqDB search
MSVLEENRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVKGNRKEAARIAAEFYG
VTQGQGSWADRSPLHEAASQGRLLALRTLLSQGYNVNAVTLDHVTPLHEACLGDHVACAR
TLLEAGANVNAITIDGVTPLFNACSQGSPSCAELLLEYGAKAQLESCLPSPTHEAASKGH
HECLDILISWGIDVDQEIPHLGTPLYVACMSQQFHCIWKLLYAGADVQKGKYWDTPLHAA
AQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC
IRSYIGKPRLHLIPQLQLPTLLKNFLQYR
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgttagaagaaaatcggccgtttgctcaacaattatccaatgtctactttaca
atactttcgctgttctgttttaagctttttgtgaaaatcagccttgccatcctcagtcat
ttctacatagtgaaaggcaaccgcaaggaagcggcaaggatagcagctgaattttatgga
gtaacccaaggacaaggttcctgggcagatcgatcaccactacatgaagcagcaagtcaa
ggtcgccttcttgctctgagaacattattatcacagggttataatgtaaatgcagtaacc
ttagaccatgtcaccccattgcacgaagcctgccttggagatcacgtggcatgtgccaga
actctgctggaagcaggagctaatgtaaatgcaatcacgatagatggcgtgactccgtta
ttcaacgcatgctcccaaggcagtccaagctgtgcagagctgcttctggagtatggtgcc
aaagcccagctggagtcatgtcttccatccccaacgcatgaggccgccagtaaaggtcac
catgaatgtcttgacatcctgatatcctggggcatagatgttgaccaagaaattcctcat
ttgggaactcctctctatgtagcttgtatgtcacagcaattccattgcatctggaagctt
ctttatgctggtgctgacgtacagaaaggcaaatattgggatactccattacatgctgct
gctcaacaatccagcacagaaattgtaaacttactgctagaatttggagcagatatcaat
gccaaaaatacagagcttctgcgacctatagatgtagctacgtctagcagtatggtggaa
aggatattgcttcaacatgaagctaccccaagctctctttaccaactttgccgactctgt
atccgaagctacataggaaaaccaagattgcaccttatcccacaactccagctgccaacg
ttactgaagaatttcttacagtatcgataa

DBGET integrated database retrieval system