KEGG   Homo sapiens (human): 140465Help
Entry
140465            CDS       T01001                                 

Gene name
MYL6B, MLC1SA
Definition
myosin, light chain 6B, alkali, smooth muscle and non-muscle
Orthology
K12751  
myosin light chain 6
Organism
hsa  Homo sapiens (human)
Pathway
Vascular smooth muscle contraction
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    140465 (MYL6B)
  Circulatory system
   04270 Vascular smooth muscle contraction
    140465 (MYL6B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   140465 (MYL6B)
  Exosomal proteins of bladder cancer cells
   140465 (MYL6B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12q13.13
AA seq 208 aa AA seqDB search
MPPKKDVPVKKPAGPSISKPAAKPAAAGAPPAKTKAEPAVPQAPQKTQEPPVDLSKVVIE
FNKDQLEEFKEAFELFDRVGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDELKSR
RVDFETFLPMLQAVAKNRGQGTYEDYLEGFRVFDKEGNGKVMGAELRHVLTTLGEKMTEE
EVETVLAGHEDSNGCINYEAFLKHILSV
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcctcccaagaaggatgttcccgtgaagaaaccagcagggccctccatctccaaacct
gctgctaagccagcagcagcaggggctcctccagccaagaccaaagctgagccagctgtc
ccccaggcccctcagaaaacccaggagcctccagtcgatctctccaaagtggtgatcgag
tttaacaaggaccagctggaggagttcaaggaggccttcgagctgtttgaccgagtgggg
gatggcaagatcctgtacagccagtgtggggacgtgatgagggccctgggccagaacccc
accaacgccgaggtgctcaaggtcctggggaaccccaagagtgatgagctgaagtcgcgg
cgtgtggactttgagactttcctgcccatgctccaggcagtggccaagaaccgaggccaa
ggcacatatgaggactacttggaggggtttcgtgtgtttgacaaggaggggaacggcaaa
gtcatgggagcagagctcagacatgttctcaccacccttggagagaagatgactgaggag
gaggtggagaccgttctggcaggacacgaggacagcaacggctgcatcaactacgaggcc
ttcttgaaacacatcctaagcgtctga

DBGET integrated database retrieval system