KEGG   Homo sapiens (human): 140628Help
Entry
140628            CDS       T01001                                 

Gene name
GATA5, GATAS, bB379O24.1
Definition
GATA binding protein 5
Orthology
K17896  
GATA-binding protein 5
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q13.33
AA seq 397 aa AA seqDB search
MYQSLALAASPRQAAYADSGSFLHAPGAGSPMFVPPARVPSMLSYLSGCEPSPQPPELAA
RPGWAQTATADSSAFGPGSPHPPAAHPPGATAFPFAHSPSGPGSGGSAGGRDGSAYQGAL
LPREQFAAPLGRPVGTSYSATYPAYVSPDVAQSWTAGPFDGSVLHGLPGRRPTFVSDFLE
EFPGEGRECVNCGALSTPLWRRDGTGHYLCNACGLYHKMNGVNRPLVRPQKRLSSSRRAG
LCCTNCHTTNTTLWRRNSEGEPVCNACGLYMKLHGVPRPLAMKKESIQTRKRKPKTIAKA
RGSSGSTRNASASPSAVASTDSSAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHL
EFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtaccagagcctggcgctggccgcgagcccccgccaggccgcctacgccgactcgggc
tccttcctgcacgctccgggcgccggctctccgatgtttgtgccgccggcgcgcgtcccc
tcgatgctgtcctacctgtccgggtgtgagccgagcccgcagccccccgagctcgctgcg
cgccccggctgggcgcagacagccaccgcggattcgtcggccttcggcccgggcagtccg
caccccccagccgcgcacccgcccggggccaccgccttccctttcgcgcacagcccctcg
gggcccggcagcggcggcagcgcggggggccgagacggcagtgcctaccagggcgcgctg
ttgcctcgagaacagttcgcggccccgcttgggcggccggtggggacctcgtactccgcc
acctacccggcctacgtgagccccgacgtggcccagtcctggactgccgggcccttcgat
ggcagcgtcctgcacggcctcccaggccgcaggcccaccttcgtgtccgacttcttggag
gagttcccgggtgagggtcgtgagtgtgtcaactgcggggccctgtccacaccgctgtgg
cgccgagacggcaccggccactacctgtgcaatgcctgcggcctctaccacaagatgaat
ggcgtcaaccggccgctcgttcggcctcagaagcgcctgtcctcgtcccgccgcgccggc
ctctgctgcaccaactgccacacgaccaacaccacgctgtggcggcggaactcggagggg
gagcccgtgtgcaatgcctgcggcctctacatgaagctgcacggggtgccgcggcctctg
gctatgaagaaggaaagcatccagacacggaagcggaagccaaagaccatcgccaaggcc
aggggctcctcaggatccacaaggaatgcctcggcctccccatctgctgtcgccagcact
gacagctcagcagccacttcgaaagccaagcccagcctggcgtccccagtgtgccctggg
cccagcatggccccccaggcctctggccaggaggatgactctcttgcccccggccacttg
gagttcaagttcgagcctgaggactttgccttcccctccacggccccaagcccccaggct
ggcctcaggggggctctgcgccaagaggcctggtgtgcgctggccttggcctag

DBGET integrated database retrieval system