KEGG   Homo sapiens (human): 140679Help
Entry
140679            CDS       T01001                                 

Gene name
SLC32A1, VGAT, VIAAT
Definition
solute carrier family 32 (GABA vesicular transporter), member 1
Orthology
K15015  
solute carrier family 32 (vesicular inhibitory amino acid transporter)
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    140679 (SLC32A1)
   04723 Retrograde endocannabinoid signaling
    140679 (SLC32A1)
   04721 Synaptic vesicle cycle
    140679 (SLC32A1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    140679 (SLC32A1)
   05033 Nicotine addiction
    140679 (SLC32A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q11.23
AA seq 525 aa AA seqDB search
MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQM
DILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE
AGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVV
RVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQ
KSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFY
IDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYL
TWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPA
CYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRL
LWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggccaccttgctccgcagcaagctgtccaacgtggccacgtccgtgtccaacaagtcc
caggccaagatgagcggcatgttcgccaggatgggttttcaggcggccacggatgaggag
gcggtgggcttcgcgcattgcgacgacctcgactttgagcaccgccagggcctgcagatg
gacatcctgaaagccgagggagagccctgcggggacgagggcgctgaagcgcccgtcgag
ggagacatccattatcagcgaggcagcggagctcctctgccgccctccggctccaaggac
caggtgggaggtggtggcgaattcgggggccacgacaagcccaaaatcacggcgtgggag
gcaggctggaacgtgaccaacgccatccagggcatgttcgtgctgggcctaccctacgcc
atcctgcacggcggctacctggggttgtttctcatcatcttcgccgccgttgtgtgctgc
tacaccggcaagatcctcatcgcgtgcctgtacgaggagaatgaagacggcgaggtggtg
cgcgtgcgggactcgtacgtggccatagccaacgcctgctgcgccccgcgcttcccaacg
ctgggcggccgagtggtgaacgtagcgcagatcatcgagctggtgatgacgtgcatcctg
tacgtggtggtgagtggcaacctcatgtacaacagcttcccggggctgcccgtgtcgcag
aagtcctggtccattatcgccacggccgtgctgctgccttgcgccttccttaagaacctc
aaggccgtgtccaagttcagtctgctgtgcactctggcccacttcgtcatcaatatcctg
gtcatagcctactgtctatcgcgggcgcgcgactgggcctgggagaaggtcaagttctac
atcgacgtcaagaagttccccatctccattggcatcatcgtgttcagctacacgtctcag
atcttcctgccttcgctggagggcaatatgcagcagcccagcgagttccactgcatgatg
aactggacgcacatcgcagcctgcgtgctcaagggcctcttcgcgctcgtcgcctacctc
acctgggccgacgagaccaaggaggtcatcacggataacctgcccggctccatccgcgcc
gtggtcaacatctttctggtggccaaggcgctgttgtcctatcctctgccattctttgcc
gctgtcgaggtgctggagaagtcgctcttccaggaaggcagccgcgcctttttcccggcc
tgctacagcggcgacgggcgcctgaagtcctgggggctgacgctgcgctgcgcgctcgtc
gtcttcacgctgctcatggccatttatgtgccgcacttcgcgctgctcatgggcctcacc
ggcagcctcacgggcgccggcctctgtttcttgctgcccagcctctttcacctgcgcctg
ctctggcgcaagctgctgtggcaccaagtcttcttcgacgtcgccatcttcgtcatcggc
ggcatctgcagcgtgtccggcttcgtgcactccctcgagggcctcatcgaagcctaccga
accaacgcggaggactag

DBGET integrated database retrieval system