KEGG   Homo sapiens (human): 140679Help
Entry
140679            CDS       T01001                                 

Gene name
SLC32A1, VGAT, VIAAT
Definition
solute carrier family 32 (GABA vesicular transporter), member 1
Orthology
K15015  
solute carrier family 32 (vesicular inhibitory amino acid transporter)
Organism
hsa  Homo sapiens (human)
Pathway
Synaptic vesicle cycle
Retrograde endocannabinoid signaling
GABAergic synapse
Morphine addiction
Nicotine addiction
Class
Organismal Systems; Nervous system; GABAergic synapse [PATH:hsa04727]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:hsa04723]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Substance dependence; Morphine addiction [PATH:hsa05032]
Human Diseases; Substance dependence; Nicotine addiction [PATH:hsa05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
20q11.23
AA seq 525 aa AA seqDB search
MATLLRSKLSNVATSVSNKSQAKMSGMFARMGFQAATDEEAVGFAHCDDLDFEHRQGLQM
DILKAEGEPCGDEGAEAPVEGDIHYQRGSGAPLPPSGSKDQVGGGGEFGGHDKPKITAWE
AGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTGKILIACLYEENEDGEVV
RVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYVVVSGNLMYNSFPGLPVSQ
KSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILVIAYCLSRARDWAWEKVKFY
IDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMMNWTHIAACVLKGLFALVAYL
TWADETKEVITDNLPGSIRAVVNIFLVAKALLSYPLPFFAAVEVLEKSLFQEGSRAFFPA
CYSGDGRLKSWGLTLRCALVVFTLLMAIYVPHFALLMGLTGSLTGAGLCFLLPSLFHLRL
LWRKLLWHQVFFDVAIFVIGGICSVSGFVHSLEGLIEAYRTNAED
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggccaccttgctccgcagcaagctgtccaacgtggccacgtccgtgtccaacaagtcc
caggccaagatgagcggcatgttcgccaggatgggttttcaggcggccacggatgaggag
gcggtgggcttcgcgcattgcgacgacctcgactttgagcaccgccagggcctgcagatg
gacatcctgaaagccgagggagagccctgcggggacgagggcgctgaagcgcccgtcgag
ggagacatccattatcagcgaggcagcggagctcctctgccgccctccggctccaaggac
caggtgggaggtggtggcgaattcgggggccacgacaagcccaaaatcacggcgtgggag
gcaggctggaacgtgaccaacgccatccagggcatgttcgtgctgggcctaccctacgcc
atcctgcacggcggctacctggggttgtttctcatcatcttcgccgccgttgtgtgctgc
tacaccggcaagatcctcatcgcgtgcctgtacgaggagaatgaagacggcgaggtggtg
cgcgtgcgggactcgtacgtggccatagccaacgcctgctgcgccccgcgcttcccaacg
ctgggcggccgagtggtgaacgtagcgcagatcatcgagctggtgatgacgtgcatcctg
tacgtggtggtgagtggcaacctcatgtacaacagcttcccggggctgcccgtgtcgcag
aagtcctggtccattatcgccacggccgtgctgctgccttgcgccttccttaagaacctc
aaggccgtgtccaagttcagtctgctgtgcactctggcccacttcgtcatcaatatcctg
gtcatagcctactgtctatcgcgggcgcgcgactgggcctgggagaaggtcaagttctac
atcgacgtcaagaagttccccatctccattggcatcatcgtgttcagctacacgtctcag
atcttcctgccttcgctggagggcaatatgcagcagcccagcgagttccactgcatgatg
aactggacgcacatcgcagcctgcgtgctcaagggcctcttcgcgctcgtcgcctacctc
acctgggccgacgagaccaaggaggtcatcacggataacctgcccggctccatccgcgcc
gtggtcaacatctttctggtggccaaggcgctgttgtcctatcctctgccattctttgcc
gctgtcgaggtgctggagaagtcgctcttccaggaaggcagccgcgcctttttcccggcc
tgctacagcggcgacgggcgcctgaagtcctgggggctgacgctgcgctgcgcgctcgtc
gtcttcacgctgctcatggccatttatgtgccgcacttcgcgctgctcatgggcctcacc
ggcagcctcacgggcgccggcctctgtttcttgctgcccagcctctttcacctgcgcctg
ctctggcgcaagctgctgtggcaccaagtcttcttcgacgtcgccatcttcgtcatcggc
ggcatctgcagcgtgtccggcttcgtgcactccctcgagggcctcatcgaagcctaccga
accaacgcggaggactag

DBGET integrated database retrieval system