KEGG   Homo sapiens (human): 140739Help
Entry
140739            CDS       T01001                                 

Gene name
UBE2F, NCE2
Definition
(RefSeq) ubiquitin conjugating enzyme E2 F (putative)
  KO
K10687  
ubiquitin-conjugating enzyme E2 F [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    140739 (UBE2F)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     140739 (UBE2F)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   140739 (UBE2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.3
AA seq 185 aa AA seqDB search
MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPN
KLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLL
REHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYI
KRYAR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgctagcaagtaaactgaagcgtgacgatggtctcaaagggtcccggacggca
gccacagcgtccgactcgactcggagggtttctgtgagagacaaattgcttgttaaagag
gttgcagaacttgaagctaatttaccttgtacatgtaaagtgcattttcctgatccaaac
aagcttcattgttttcagctaacagtaaccccagatgagggttactaccagggtggaaaa
tttcagtttgaaactgaagttcccgatgcgtacaacatggtgcctcccaaagtgaaatgc
ctgaccaagatctggcaccccaacatcacagagacaggggaaatatgtctgagtttattg
agagaacattcaattgatggcactggctgggctcccacaagaacattaaaggatgtcgtt
tggggattaaactctttgtttactgatcttttgaattttgatgatccactgaatattgaa
gctgcagaacatcatttgcgggacaaggaggacttccggaataaagtggatgactacatc
aaacgttatgccagatga

DBGET integrated database retrieval system