KEGG   Homo sapiens (human): 140739Help
Entry
140739            CDS       T01001                                 

Gene name
UBE2F, NCE2
Definition
ubiquitin-conjugating enzyme E2F (putative)
Orthology
K10687  
ubiquitin-conjugating enzyme E2 F [EC:6.3.2.19]
Organism
hsa  Homo sapiens (human)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    140739 (UBE2F)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.19  ubiquitin---protein ligase
     140739 (UBE2F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2q37.3
AA seq 185 aa AA seqDB search
MLTLASKLKRDDGLKGSRTAATASDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPN
KLHCFQLTVTPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLL
REHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRNKVDDYI
KRYAR
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgctagcaagtaaactgaagcgtgacgatggtctcaaagggtcccggacggca
gccacagcgtccgactcgactcggagggtttctgtgagagacaaattgcttgttaaagag
gttgcagaacttgaagctaatttaccttgtacatgtaaagtgcattttcctgatccaaac
aagcttcattgttttcagctaacagtaaccccagatgagggttactaccagggtggaaaa
tttcagtttgaaactgaagttcccgatgcgtacaacatggtgcctcccaaagtgaaatgc
ctgaccaagatctggcaccccaacatcacagagacaggggaaatatgtctgagtttattg
agagaacattcaattgatggcactggctgggctcccacaagaacattaaaggatgtcgtt
tggggattaaactctttgtttactgatcttttgaattttgatgatccactgaatattgaa
gctgcagaacatcatttgcgggacaaggaggacttccggaataaagtggatgactacatc
aaacgttatgccagatga

DBGET integrated database retrieval system