KEGG   Homo sapiens (human): 140803Help
Entry
140803            CDS       T01001                                 

Gene name
TRPM6, CHAK2, HMGX, HOMG, HOMG1, HSH
Definition
(RefSeq) transient receptor potential cation channel subfamily M member 6 (EC:2.7.11.1)
  KO
K04981  
transient receptor potential cation channel subfamily M member 6 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Mineral absorption
Disease
H01210  
Hypomagnesemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Digestive system
   04978 Mineral absorption
    140803 (TRPM6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     140803 (TRPM6)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   140803 (TRPM6)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPM (Melastatin/Long TRP)
   140803 (TRPM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
9q21.13
AA seq 2022 aa AA seqDB search
MKEQPVLERLQSQKSWIKGVFDKRECSTIIPSSKNPHRCTPVCQVCQNLIRCYCGRLIGD
HAGIDYSWTISAAKGKESEQWSVEKHTTKSPTDTFGTINFQDGEHTHHAKYIRTSYDTKL
DHLLHLMLKEWKMELPKLVISVHGGIQNFTMPSKFKEIFSQGLVKAAETTGAWIITEGIN
TGVSKHVGDALKSHSSHSLRKIWTVGIPPWGVIENQRDLIGKDVVCLYQTLDNPLSKLTT
LNSMHSHFILSDDGTVGKYGNEMKLRRNLEKYLSLQKIHCRSRQGVPVVGLVVEGGPNVI
LSVWETVKDKDPVVVCEGTGRAADLLAFTHKHLADEGMLRPQVKEEIICMIQNTFNFSLK
QSKHLFQILMECMVHRDCITIFDADSEEQQDLDLAILTALLKGTNLSASEQLNLAMAWDR
VDIAKKHILIYEQHWKPDALEQAMSDALVMDRVDFVKLLIEYGVNLHRFLTIPRLEELYN
TKQGPTNTLLHHLVQDVKQHTLLSGYRITLIDIGLVVEYLIGRAYRSNYTRKHFRALYNN
LYRKYKHQRHSSGNRNESAESTLHSQFIRTAQPYKFKEKSIVLHKSRKKSKEQNVSDDPE
STGFLYPYNDLLVWAVLMKRQKMAMFFWQHGEEATVKAVIACILYRAMAHEAKESHMVDD
ASEELKNYSKQFGQLALDLLEKAFKQNERMAMTLLTYELRNWSNSTCLKLAVSGGLRPFV
SHTCTQMLLTDMWMGRLKMRKNSWLKIIISIILPPTILTLEFKSKAEMSHVPQSQDFQFM
WYYSDQNASSSKESASVKEYDLERGHDEKLDENQHFGLESGHQHLPWTRKVYEFYSAPIV
KFWFYTMAYLAFLMLFTYTVLVEMQPQPSVQEWLVSIYIFTNAIEVVREICISEPGKFTQ
KVKVWISEYWNLTETVAIGLFSAGFVLRWGDPPFHTAGRLIYCIDIIFWFSRLLDFFAVN
QHAGPYVTMIAKMTANMFYIVIIMAIVLLSFGVARKAILSPKEPPSWSLARDIVFEPYWM
IYGEVYAGEIDVCSSQPSCPPGSFLTPFLQAVYLFVQYIIMVNLLIAFFNNVYLDMESIS
NNLWKYNRYRYIMTYHEKPWLPPPLILLSHVGLLLRRLCCHRAPHDQEEGDVGLKLYLSK
EDLKKLHDFEEQCVEKYFHEKMEDVNCSCEERIRVTSERVTEMYFQLKEMNEKVSFIKDS
LLSLDSQVGHLQDLSALTVDTLKVLSAVDTLQEDEALLAKRKHSTCKKLPHSWSNVICAE
VLGSMEIAGEKKYQYYSMPSSLLRSLAGGRHPPRVQRGALLEITNSKREATNVRNDQERQ
ETQSSIVVSGVSPNRQAHSKYGQFLLVPSNLKRVPFSAETVLPLSRPSVPDVLATEQDIQ
TEVLVHLTGQTPVVSDWASVDEPKEKHEPIAHLLDGQDKAEQVLPTLSCTPEPMTMSSPL
SQAKIMQTGGGYVNWAFSEGDETGVFSIKKKWQTCLPSTCDSDSSRSEQHQKQAQDSSLS
DNSTRSAQSSECSEVGPWLQPNTSFWINPLRRYRPFARSHSFRFHKEEKLMKICKIKNLS
GSSEIGQGAWVKAKMLTKDRRLSKKKKNTQGLQVPIITVNACSQSDQLNPEPGENSISEE
EYSKNWFTVSKFSHTGVEPYIHQKMKTKEIGQCAIQISDYLKQSQEDLSKNSLWNSRSTN
LNRNSLLKSSIGVDKISASLKSPQEPHHHYSAIERNNLMRLSQTIPFTPVQLFAGEEITV
YRLEESSPLNLDKSMSSWSQRGRAAMIQVLSREEMDGGLRKAMRVVSTWSEDDILKPGQV
FIVKSFLPEVVRTWHKIFQESTVLHLCLREIQQQRAAQKLIYTFNQVKPQTIPYTPRFLE
VFLIYCHSANQWLTIEKYMTGEFRKYNNNNGDEITPTNTLEELMLAFSHWTYEYTRGELL
VLDLQGVGENLTDPSVIKPEVKQSRGMVFGPANLGEDAIRNFIAKHHCNSCCRKLKLPDL
KRNDYSPERINSTFGLEIKIESAEEPPARETGRNSPEDDMQL
NT seq 6069 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaacaacctgtcttggagcgcttgcagtcccagaaatcctggattaaaggagta
tttgacaagagagaatgtagcacaatcatacccagctcaaaaaatcctcacagatgtact
ccagtatgccaagtctgccagaatttaatcaggtgttactgtggccgactgattggagac
catgctgggatagattattcctggaccatctcagctgccaagggtaaagaaagtgaacaa
tggtctgttgaaaagcacacaacgaaaagcccaacagatacttttggcacgattaatttc
caagatggagagcacacccatcatgccaagtatattagaacttcttatgatacaaaactg
gatcatctgttacatttaatgttgaaagagtggaaaatggaactgcccaagcttgtgatc
tcagtccatgggggcatccagaactttactatgccctctaaatttaaagagattttcagc
caaggtttggttaaagctgcagagacaacaggagcgtggataataactgaaggcatcaat
acaggagtgtccaagcatgttggggatgccttgaaatcccattcctctcattccttgaga
aaaatctggacagttggaatccctccttggggtgtcattgagaaccagagagaccttatt
ggaaaagatgtggtgtgcctgtaccagactctggataaccccctcagcaagctcacaaca
ctcaacagcatgcactcgcacttcatcctgtctgatgatgggaccgtgggcaagtatgga
aatgaaatgaagctcagaaggaacctggagaagtacctctctctgcagaaaatacactgc
cgctcaagacaaggcgtgccggtcgtggggctggtggtggaaggcggtcccaacgtcatc
ctgtcagtgtgggagactgtcaaggacaaggacccagtggtggtgtgtgagggcacaggt
agggcggctgacctcctggccttcacacacaaacacctggcagatgaagggatgctgcga
cctcaggtgaaagaggagatcatctgcatgattcagaacactttcaactttagtcttaaa
cagtccaagcaccttttccaaattctaatggagtgtatggttcacagggattgtattacc
atatttgatgctgactctgaagagcagcaagacctggacttagcaatcctaacagctttg
ctgaagggcacaaatttatcagcgtcagagcaattaaatctggcaatggcttgggacagg
gtggacattgccaagaaacatatcctaatttatgaacaacactggaagcctgatgccctg
gaacaagcaatgtcagatgctttagtgatggatcgggtggattttgtgaagctcttaata
gaatatggagtgaacctccatcgctttcttaccatccctcgactggaagagctctacaat
acaaaacaaggacctactaatacactcttgcatcatctcgtccaagatgtgaaacagcat
acccttctttcaggctaccgaataaccttgattgacattggattagtagtagaatacctc
attggtagagcatatcgcagcaactacactagaaaacatttcagagccctctacaacaac
ctctacagaaaatacaagcaccagagacactcctcaggaaatagaaatgagtctgcagaa
agtacgctgcactcccagttcattagaactgcacagccatacaaattcaaggaaaagtct
atagtccttcataaatcaaggaagaagtcaaaagaacaaaatgtatcagatgaccctgag
tctactggctttctttacccttacaatgacctgctggtttgggctgtgctgatgaaaagg
cagaagatggctatgttcttctggcagcatggagaggaggccacggttaaagccgtgatt
gcgtgtatcctctaccgggcaatggcccatgaagctaaggagagtcacatggtggatgat
gcctcagaagagttgaagaattactcaaaacagtttggccagctggctctggacttgttg
gagaaggcattcaagcagaatgagcgcatggccatgacgctgttgacgtatgaactcagg
aactggagcaattcgacctgccttaaactggccgtgtcgggaggattacgaccctttgtt
tcacatacttgtacccagatgctactgacagacatgtggatggggaggctgaaaatgagg
aaaaactcttggttaaagattattataagcattattttaccacccaccattttgacactg
gaatttaaaagcaaagctgagatgtcacatgttccccagtcccaggacttccaatttatg
tggtattacagtgaccagaacgccagcagttccaaagaaagtgcttctgtgaaagagtat
gatttggaaaggggccatgatgagaaactggatgaaaatcagcattttggtttggaaagt
gggcaccaacaccttccgtggaccaggaaagtctatgagttctacagtgctccaattgtc
aagttttggttttatacgatggcgtatttggcattcctcatgctgttcacttacaccgtg
ttggtggagatgcagccccagcccagcgtgcaggagtggcttgttagcatttacatcttc
accaatgctattgaggtggtcagggagatctgtatttcagaacctgggaagtttacccaa
aaggtgaaggtatggattagtgagtactggaacttaacagaaactgtggccattggcctg
ttttcagctggcttcgtccttcgatggggtgaccctccttttcacacagcgggaagactg
atctactgcatagacatcatattctggttctcacggctcctggacttctttgctgtgaat
caacatgcaggtccatatgtgaccatgattgcaaaaatgacagcaaacatgttctatatt
gtgatcatcatggccatagtcctgctgagctttggagtggcacgcaaggccatcctttcg
ccaaaagagccaccatcttggagtctagctcgagatattgtatttgagccatactggatg
atatacggagaagtctatgctggagaaatagatgtttgttcaagccagccatcctgccct
cctggttcttttcttactccattcttgcaagctgtctacctcttcgtgcaatatatcatc
atggtgaacctgttgattgctttcttcaacaacgtttacttagatatggaatccatttca
aataacctgtggaaatacaaccgctatcgctacatcatgacctaccacgagaagccctgg
ctgcccccacctctcatcctgctgagccacgtgggccttctcctccgccgcctgtgctgt
catcgagctcctcacgaccaagaagagggtgacgttggattaaaactctacctcagtaag
gaggatctgaaaaaacttcatgattttgaggagcagtgcgtggaaaaatacttccatgag
aagatggaagatgtgaattgtagttgtgaggaacgaatccgagtgacatcagaaagggtt
acagagatgtacttccagctgaaagaaatgaatgaaaaggtgtcttttataaaggactcc
ttactgtctttggacagccaggtgggacacctgcaggatctctctgccctgactgtggat
accctgaaagtcctttctgctgttgacactttgcaagaggatgaggctctcctggccaag
agaaagcattctacttgcaaaaaacttccccacagctggagcaatgtcatctgtgcagag
gttctaggcagcatggagatcgctggagagaagaaataccagtattatagcatgccctct
tctttgctgaggagcctggctggaggccggcatcccccaagagtgcagaggggggcactt
cttgagattacaaacagtaaaagagaggctacaaatgtaagaaatgaccaggaaaggcaa
gaaacacaaagtagtatagtggtttctggggtgtctcctaacaggcaagcacactcaaag
tatggccagtttcttctggtcccctctaatctaaagcgagttcctttttcagcagaaact
gtcttgcctctgtccagaccctctgtgccagatgtgctggcaactgaacaggacatccag
actgaggttcttgttcatctgactgggcagaccccagttgtctctgactgggcatcagtg
gatgaacccaaggaaaagcacgagcctattgctcacttactggatggacaagacaaggca
gagcaagtgctacccactttgagttgcacacctgaacccatgacaatgagctcccctctt
tcccaagccaagatcatgcaaactggaggtggatatgtaaactgggcattttcagaaggt
gatgaaactggtgtgtttagcatcaagaaaaagtggcaaacctgcttgccctccacttgt
gacagtgattcctctcggagtgaacagcaccagaagcaggcccaggacagctccctatct
gataactcaacaagatcggcccagagtagtgaatgctcagaggtgggaccatggcttcag
ccaaacacatccttttggatcaatcctctccgcagatacaggcccttcgctaggagtcat
agttttagattccataaggaggagaaattgatgaagatctgtaagattaaaaatctttca
ggctcttcagaaatagggcagggagcatgggtcaaagcgaaaatgctaaccaaagacagg
agactgtcaaagaaaaagaagaatactcaaggactccaggtgccaatcataacagtcaat
gcctgctctcagagtgaccagttgaatccagagccaggagaaaacagcatctctgaagag
gagtacagcaagaactggttcacagtgtccaaatttagtcacacaggtgtagaaccttac
atacatcagaaaatgaaaactaaagaaattggacaatgtgctatacaaatcagtgattac
ctaaagcagtctcaagaggatctcagcaaaaactctttgtggaattccaggagcaccaac
ctcaataggaactccctgctgaaaagttcaattggagttgacaagatctcagcctcctta
aaaagccctcaagagcctcaccatcattattcagccattgaaaggaataatttaatgagg
ctttctcagaccataccatttacaccagtccaactgtttgcaggagaagaaataactgtc
tacaggttggaggagagttcccctttaaaccttgataaaagcatgtcctcttggtctcag
cgtgggagagcggcaatgatccaggtattgtcccgagaggagatggatgggggcctccgt
aaagctatgagagtcgtcagcacttggtctgaggatgacattctcaagccgggacaagtt
ttcattgtcaagtcctttcttcctgaggttgtgcggacatggcataaaatcttccaggag
agcactgtgcttcatctttgcctcagggaaattcaacaacaaagagctgctcaaaaattg
atctataccttcaaccaagtgaaaccacaaaccataccctacacaccaaggttcctggaa
gttttcttaatctactgccattcagccaaccagtggttgaccattgagaagtatatgaca
ggggagttccggaagtataacaacaacaatggtgatgaaatcacccccaccaacaccctg
gaggagctgatgttggctttctctcactggacctatgagtacactcggggagagctgctg
gttttagatttgcaaggtgttggagaaaatttgacagatccatctgttataaaacctgaa
gtcaaacaatcaagaggaatggtgtttggaccggccaatttgggggaagatgcaattaga
aacttcattgcaaaacatcattgtaactcctgctgccggaagctcaaactcccggattta
aaaagaaatgactattcccctgaaaggataaattccacctttggacttgagataaaaata
gaatcagctgaggagcctccagcaagggagacgggtagaaattccccagaagatgatatg
caactataa

DBGET integrated database retrieval system