KEGG   Homo sapiens (human): 1409Help
Entry
1409              CDS       T01001                                 

Gene name
CRYAA, CRYA1, CTRCT9, HSPB4
Definition
(RefSeq) crystallin alpha A
  KO
K09541  crystallin, alpha A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Disease
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1409 (CRYAA)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP20
   1409 (CRYAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Crystallin HSP20
Motif
Other DBs
NCBI-GeneID: 1409
NCBI-ProteinID: NP_000385
OMIM: 123580
HGNC: 2388
Ensembl: ENSG00000160202
Vega: OTTHUMG00000086842
Pharos: P02489(Tbio)
UniProt: P02489 A0A140G945
Position
21q22.3
AA seq 173 aa AA seqDB search
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSG
ISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRL
PSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgaccatccagcacccctggttcaagcgcaccctggggcccttctaccccagc
cggctgttcgaccagtttttcggcgagggcctttttgagtatgacctgctgcccttcctg
tcgtccaccatcagcccctactaccgccagtccctcttccgcaccgtgctggactccggc
atctctgaggttcgatccgaccgggacaagttcgtcatcttcctcgatgtgaagcacttc
tccccggaggacctcaccgtgaaggtgcaggacgactttgtggagatccacggaaagcac
aacgagcgccaggacgaccacggctacatttcccgtgagttccaccgccgctaccgcctg
ccgtccaacgtggaccagtcggccctctcttgctccctgtctgccgatggcatgctgacc
ttctgtggccccaagatccagactggcctggatgccacccacgccgagcgagccatcccc
gtgtcgcgggaggagaagcccacctcggctccctcgtcctaa

DBGET integrated database retrieval system