KEGG   Homo sapiens (human): 1409Help
Entry
1409              CDS       T01001                                 

Gene name
CRYAA, CRYA1, CTRCT9, HSPB4
Definition
crystallin, alpha A
Orthology
K09541  
crystallin, alpha A
Organism
hsa  Homo sapiens (human)
Pathway
Protein processing in endoplasmic reticulum
Disease
H01202  
Cataract
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:hsa04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 173 aa AA seqDB search
MDVTIQHPWFKRTLGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSG
ISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVEIHGKHNERQDDHGYISREFHRRYRL
PSNVDQSALSCSLSADGMLTFCGPKIQTGLDATHAERAIPVSREEKPTSAPSS
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggacgtgaccatccagcacccctggttcaagcgcaccctggggcccttctaccccagc
cggctgttcgaccagtttttcggcgagggcctttttgagtatgacctgctgcccttcctg
tcgtccaccatcagcccctactaccgccagtccctcttccgcaccgtgctggactccggc
atctctgaggttcgatccgaccgggacaagttcgtcatcttcctcgatgtgaagcacttc
tccccggaggacctcaccgtgaaggtgcaggacgactttgtggagatccacggaaagcac
aacgagcgccaggacgaccacggctacatttcccgtgagttccaccgccgctaccgcctg
ccgtccaacgtggaccagtcggccctctcttgctccctgtctgccgatggcatgctgacc
ttctgtggccccaagatccagactggcctggatgccacccacgccgagcgagccatcccc
gtgtcgcgggaggagaagcccacctcggctccctcgtcctaa

DBGET integrated database retrieval system