KEGG   Homo sapiens (human): 142Help
Entry
142               CDS       T01001                                 

Gene name
PARP1, ADPRT, ADPRT_1, ADPRT1, ARTD1, PARP, PARP-1, PPOL, pADPRT-1
Definition
poly (ADP-ribose) polymerase 1 (EC:2.4.2.30)
Orthology
K10798  
poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
hsa  Homo sapiens (human)
Pathway
Base excision repair
NF-kappa B signaling pathway
Module
BER complex
Drug target
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    142 (PARP1)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    142 (PARP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     142 (PARP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q41-q42
AA seq 1014 aa AA seqDB search
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQDGIGSKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQVRLSKKMVDPEKPQLGMIDRWYHPGCFVKNREELGFRPEYSASQ
LKGFSLLATEDKEALKKQLPGVKSEGKRKGDEVDGVDEVAKKKSKKEKDKDSKLEKALKA
QNDLIWNIKDELKKVCSTNDLKELLIFNKQQVPSGESAILDRVADGMVFGALLPCEECSG
QLVFKSDAYYCTGDVTAWTKCMVKTQTPNRKEWVTPKEFREISYLKKLKVKKQDRIFPPE
TSASVAATPPPSTASAPAAVNSSASADKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLT
GTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSP
WGAEVKAEPVEVVAPRGKSGAALSKKSKGQVKEEGINKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPG
TKSKLPKPVQDLIKMIFDVESMKKAMVEYEIDLQKMPLGKLSKRQIQAAYSILSEVQQAV
SQGSSDSQILDLSNRFYTLIPHDFGMKKPPLLNNADSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEIIRKYVKNTHATTHNAYDLEVIDIFKIE
REGECQRYKPFKQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTTPDPSA
NISLDGVDVPLGTGISSGVNDTSLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atggcggagtcttcggataagctctatcgagtcgagtacgccaagagcgggcgcgcctct
tgcaagaaatgcagcgagagcatccccaaggactcgctccggatggccatcatggtgcag
tcgcccatgtttgatggaaaagtcccacactggtaccacttctcctgcttctggaaggtg
ggccactccatccggcaccctgacgttgaggtggatgggttctctgagcttcggtgggat
gaccagcagaaagtcaagaagacagcggaagctggaggagtgacaggcaaaggccaggat
ggaattggtagcaaggcagagaagactctgggtgactttgcagcagagtatgccaagtcc
aacagaagtacgtgcaaggggtgtatggagaagatagaaaagggccaggtgcgcctgtcc
aagaagatggtggacccggagaagccacagctaggcatgattgaccgctggtaccatcca
ggctgctttgtcaagaacagggaggagctgggtttccggcccgagtacagtgcgagtcag
ctcaagggcttcagcctccttgctacagaggataaagaagccctgaagaagcagctccca
ggagtcaagagtgaaggaaagagaaaaggcgatgaggtggatggagtggatgaagtggcg
aagaagaaatctaaaaaagaaaaagacaaggatagtaagcttgaaaaagccctaaaggct
cagaacgacctgatctggaacatcaaggacgagctaaagaaagtgtgttcaactaatgac
ctgaaggagctactcatcttcaacaagcagcaagtgccttctggggagtcggcgatcttg
gaccgagtagctgatggcatggtgttcggtgccctccttccctgcgaggaatgctcgggt
cagctggtcttcaagagcgatgcctattactgcactggggacgtcactgcctggaccaag
tgtatggtcaagacacagacacccaaccggaaggagtgggtaaccccaaaggaattccga
gaaatctcttacctcaagaaattgaaggttaaaaaacaggaccgtatattccccccagaa
accagcgcctccgtggcggccacgcctccgccctccacagcctcggctcctgctgctgtg
aactcctctgcttcagcagataagccattatccaacatgaagatcctgactctcgggaag
ctgtcccggaacaaggatgaagtgaaggccatgattgagaaactcggggggaagttgacg
gggacggccaacaaggcttccctgtgcatcagcaccaaaaaggaggtggaaaagatgaat
aagaagatggaggaagtaaaggaagccaacatccgagttgtgtctgaggacttcctccag
gacgtctccgcctccaccaagagccttcaggagttgttcttagcgcacatcttgtcccct
tggggggcagaggtgaaggcagagcctgttgaagttgtggccccaagagggaagtcaggg
gctgcgctctccaaaaaaagcaagggccaggtcaaggaggaaggtatcaacaaatctgaa
aagagaatgaaattaactcttaaaggaggagcagctgtggatcctgattctggactggaa
cactctgcgcatgtcctggagaaaggtgggaaggtcttcagtgccacccttggcctggtg
gacatcgttaaaggaaccaactcctactacaagctgcagcttctggaggacgacaaggaa
aacaggtattggatattcaggtcctggggccgtgtgggtacggtgatcggtagcaacaaa
ctggaacagatgccgtccaaggaggatgccattgagcacttcatgaaattatatgaagaa
aaaaccgggaacgcttggcactccaaaaatttcacgaagtatcccaaaaagttctacccc
ctggagattgactatggccaggatgaagaggcagtgaagaagctgacagtaaatcctggc
accaagtccaagctccccaagccagttcaggacctcatcaagatgatctttgatgtggaa
agtatgaagaaagccatggtggagtatgagatcgaccttcagaagatgcccttggggaag
ctgagcaaaaggcagatccaggccgcatactccatcctcagtgaggtccagcaggcggtg
tctcagggcagcagcgactctcagatcctggatctctcaaatcgcttttacaccctgatc
ccccacgactttgggatgaagaagcctccgctcctgaacaatgcagacagtgtgcaggcc
aaggtggaaatgcttgacaacctgctggacatcgaggtggcctacagtctgctcagggga
gggtctgatgatagcagcaaggatcccatcgatgtcaactatgagaagctcaaaactgac
attaaggtggttgacagagattctgaagaagccgagatcatcaggaagtatgttaagaac
actcatgcaaccacacacaatgcgtatgacttggaagtcatcgatatctttaagatagag
cgtgaaggcgaatgccagcgttacaagccctttaagcagcttcataaccgaagattgctg
tggcacgggtccaggaccaccaactttgctgggatcctgtcccagggtcttcggatagcc
ccgcctgaagcgcccgtgacaggctacatgtttggtaaagggatctatttcgctgacatg
gtctccaagagtgccaactactgccatacgtctcagggagacccaataggcttaatcctg
ttgggagaagttgcccttggaaacatgtatgaactgaagcacgcttcacatatcagcaag
ttacccaagggcaagcacagtgtcaaaggtttgggcaaaactacccctgatccttcagct
aacattagtctggatggtgtagacgttcctcttgggaccgggatttcatctggtgtgaat
gacacctctctactatataacgagtacattgtctatgatattgctcaggtaaatctgaag
tatctgctgaaactgaaattcaattttaagacctccctgtggtaa

DBGET integrated database retrieval system