KEGG   Homo sapiens (human): 1429Help
Entry
1429              CDS       T01001                                 

Gene name
CRYZ
Definition
(RefSeq) crystallin zeta (EC:1.6.5.5)
  KO
K00344  
NADPH2:quinone reductase [EC:1.6.5.5]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.5  NADPH:quinone reductase
     1429 (CRYZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p31.1
AA seq 329 aa AA seqDB search
MATGQKLMRAVRVFEFGGPEVLKLRSDIAVPIPKDHQVLIKVHACGVNPVETYIRSGTYS
RKPLLPYTPGSDVAGVIEAVGDNASAFKKGDRVFTSSTISGGYAEYALAADHTVYKLPEK
LDFKQGAAIGIPYFTAYRALIHSACVKAGESVLVHGASGGVGLAACQIARAYGLKILGTA
GTEEGQKIVLQNGAHEVFNHREVNYIDKIKKYVGEKGIDIIIEMLANVNLSKDLSLLSHG
GRVIVVGSRGTIEINPRDTMAKESSIIGVTLFSSTKEEFQQYAAALQAGMEIGWLKPVIG
SQYPLEKVAEAHENIIHGSGATGKMILLL
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggcgactggacagaagttgatgagagctgttagagtttttgaatttggtgggccagaa
gtcctgaaattgcgatcagatattgcagtaccgattccaaaagaccatcaggttctaatc
aaggtccatgcatgtggtgtcaaccccgtggagacatacattcgctctggtacttatagt
agaaaaccactcttaccctatactcctggctcagatgtggctggggtgatagaagctgtt
ggagataatgcatctgctttcaagaaaggtgacagagttttcactagcagcacgatctct
gggggttatgcagagtatgctcttgcagcagaccacactgtttacaaactacctgaaaaa
ctggactttaaacaaggagctgccatcggcattccatattttactgcttatcgagctctg
atccacagtgcctgtgtgaaagctggagagagtgttctggttcatggggcaagtggagga
gttggattagcagcatgccaaattgctagagcttatggcttaaagattttgggcactgct
ggtactgaggaaggacaaaagattgttttgcaaaatggagcccatgaagtgttcaatcac
agagaagtgaattacattgataaaattaagaagtatgttggtgagaaaggaattgatata
attattgaaatgttagctaatgtaaatcttagtaaagacttgagtcttctgtcacatgga
ggacgagtgatagttgttggcagcagaggtactattgaaataaacccacgagacaccatg
gcaaaggagtcgagtataattggagttactctcttttcctcaaccaaggaggaatttcag
caatatgcagcagcccttcaagctggaatggaaattggctggttgaaacctgtgataggt
tctcaatatccattggagaaggtggccgaggctcatgaaaatatcattcatggtagtggg
gctactggaaaaatgattcttctcttatga

DBGET integrated database retrieval system