KEGG   Homo sapiens (human): 143187Help
Entry
143187            CDS       T01001                                 

Gene name
VTI1A, MMDS3, MVti1, VTI1RP2, Vti1-rp2
Definition
vesicle transport through interaction with t-SNAREs 1A
Orthology
K08493  
vesicle transport through interaction with t-SNAREs 1
Organism
hsa  Homo sapiens (human)
Pathway
SNARE interactions in vesicular transport
Class
Genetic Information Processing; Folding, sorting and degradation; SNARE interactions in vesicular transport [PATH:hsa04130]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10q25.2
AA seq 217 aa AA seqDB search
MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVR
EIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLD
NTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRI
LTGMLRRIIQNRILLVILGIIVVITILMAITFSVRRH
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgacttcgaaggttacgagcaggacttcgcggtgctcactgcagagatcacc
agcaagattgcgagggtcccacgactcccgcctgatgaaaagaaacagatggttgcaaat
gtggagaaacagcttgaagaagcgaaagaactgcttgaacagatggatttggaagtccga
gagataccaccccaaagtcgagggatgtacagcaacagaatgagaagctacaaacaagaa
atgggaaaactcgaaacagattttaaaaggtcacggatcgcctacagtgacgaagtacgg
aatgagctcctgggggatgatgggaattcctcagagaaccagagggcacatctgctcgat
aacacagagaggctggaaaggtcatctcggagactagaggctggataccaaatagcagtg
gaaaccgagcaaattggtcaggagatgttggaaaaccttagtcatgacagagaaaagata
cagcgagcacgtgaaagacttcgggaaacagatgctaatttgggaaaaagctccaggatt
ctgacagggatgttgcgaagaatcatccagaaccgcatcctgctcgtcatcctagggatc
atcgtggtcatcaccatcctgatggcgatcactttttctgtcagaagacactga

DBGET integrated database retrieval system