KEGG   Homo sapiens (human): 143187Help
Entry
143187            CDS       T01001                                 

Gene name
VTI1A, MMDS3, MVti1, VTI1RP2, Vti1-rp2
Definition
(RefSeq) vesicle transport through interaction with t-SNAREs 1A
  KO
K08493  vesicle transport through interaction with t-SNAREs 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04130  SNARE interactions in vesicular transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04130 SNARE interactions in vesicular transport
    143187 (VTI1A)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNAP-25[N] (Qb)
   Vti1
    143187 (VTI1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-SNARE V-SNARE_C LMBR1 Laminin_II Sec20 DUF1664 MMPL Fusion_gly Mer2 DUF5344 DUF1542 DUF241
Motif
Other DBs
NCBI-GeneID: 143187
NCBI-ProteinID: NP_660207
OMIM: 614316
HGNC: 17792
Ensembl: ENSG00000151532
Vega: OTTHUMG00000019063
Pharos: Q96AJ9(Tbio)
UniProt: Q96AJ9
Position
10q25.2
AA seq 217 aa AA seqDB search
MSSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKELLEQMDLEVR
EIPPQSRGMYSNRMRSYKQEMGKLETDFKRSRIAYSDEVRNELLGDDGNSSENQRAHLLD
NTERLERSSRRLEAGYQIAVETEQIGQEMLENLSHDREKIQRARERLRETDANLGKSSRI
LTGMLRRIIQNRILLVILGIIVVITILMAITFSVRRH
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccgacttcgaaggttacgagcaggacttcgcggtgctcactgcagagatcacc
agcaagattgcgagggtcccacgactcccgcctgatgaaaagaaacagatggttgcaaat
gtggagaaacagcttgaagaagcgaaagaactgcttgaacagatggatttggaagtccga
gagataccaccccaaagtcgagggatgtacagcaacagaatgagaagctacaaacaagaa
atgggaaaactcgaaacagattttaaaaggtcacggatcgcctacagtgacgaagtacgg
aatgagctcctgggggatgatgggaattcctcagagaaccagagggcacatctgctcgat
aacacagagaggctggaaaggtcatctcggagactagaggctggataccaaatagcagtg
gaaaccgagcaaattggtcaggagatgttggaaaaccttagtcatgacagagaaaagata
cagcgagcacgtgaaagacttcgggaaacagatgctaatttgggaaaaagctccaggatt
ctgacagggatgttgcgaagaatcatccagaaccgcatcctgctcgtcatcctagggatc
atcgtggtcatcaccatcctgatggcgatcactttttctgtcagaagacactga

DBGET integrated database retrieval system